KEGG   Lactococcus lactis subsp. lactis NCDO 2118: NCDO2118_0722Help
Entry
NCDO2118_0722     CDS       T03437                                 

Gene name
cydD
Definition
(GenBank) Cytochrome D ABC transporter
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
llx  Lactococcus lactis subsp. lactis NCDO 2118
Pathway
llx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:llx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NCDO2118_0722 (cydD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:llx02000]
    NCDO2118_0722 (cydD)
Transporters [BR:llx02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    NCDO2118_0722 (cydD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane RsgA_GTPase AAA_21 DUF87 AAA_29 IstB_IS21 AAA_16 MMR_HSR1 AAA_22 SMC_N
Motif
Other DBs
NCBI-ProteinID: AII12214
LinkDB All DBs
Position
739712..741433
Genome map
AA seq 573 aa AA seqDB search
MKLKNILFGNDWISPFLKKNRSGFILSIFLGTITISMAGLLMFSSGYVISKSATKPENIL
MIYVPVLFVRIFGIGRPVMHYVERLTSHNWILKITSLLRKKLYLRLEKTAVTLADRYRLG
DLLGVLNEDIGNLQDLFLRTLFPVLIAGSLSIALIIAGGFFSLWFALGLALFLGFLIVIL
PLISLKFTVKLDEELKIYRNQLFSHLTDDILGLQDWVLSGRKEDFLTAYRGSELSARKIQ
AKLLAFGRRRNLFLQVVYGALVIYLMIWSSGALRLGDAPNYIAAVSLAAFPLFDAFSPLS
DAVVETQRYGDSINRLNDLPDQDEEVRTEEIVSTDLVINNLQFSFEENKKIFDNFNLEVK
QGEHIALLGRSGVGKSTLAGLIRGDLVPQSGSIQFSGVEPSKAKNVEEKIGVINQSPYLF
ATSLRSNLTLAKLNASDAEIWEALEFVGLRKMVESLPQKLLTPVDEAGERFSGGERQRLA
LARVLLSDVDVVILDEPTVSLDPITENQLLSLFFEQLRDKSIIFITHHLLGVHHMDRVLF
LENGSIKFDGKPASLLENNPTFKELYQLDLGNE
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaaaatattttgtttggtaatgactggatttctccatttttgaaaaaaaat
cgttcaggatttattctatctattttcttaggaacgattacaatttcgatggcgggactt
ttgatgttcagctcaggatatgtcatttctaaatcagcaacaaaaccagaaaatatttta
atgatttatgttccagttctctttgtacgtatttttgggattggacgaccagtgatgcat
tatgtcgaaagattaacttctcataattggattttaaaaatcacaagtctcttacgaaaa
aaactctatttgcgactggaaaaaacggccgttacattagcagatcgttaccgtttaggt
gacttattgggtgttcttaatgaagatattggaaatctacaagacctatttttgagaaca
ttatttccagttttaattgctggaagtttatcgattgctctaattattgctggaggattt
ttctcactttggtttgctttaggtttagcgctcttcttaggatttttgattgttatcttg
ccattaatttctttgaaatttacagtaaaattagatgaagaactcaaaatttatcgcaat
caacttttttctcatttgacagatgatattttaggattacaagattgggtgctttcagga
cgaaaagaagattttctgacagcttatcgaggttctgaattatctgctagaaaaattcaa
gccaaactattagctttcggacgtagaagaaatttatttttacaagttgtctatggcgca
ttagtgatttatttgatgatttggtcttctggtgctttaagattaggagacgcgcctaat
tatattgcggcagttagtctcgctgccttccctttatttgatgctttttctcctttgtct
gatgcggtggttgaaacacaacgttatggcgattcaatcaatcgtttaaatgacttacca
gaccaagatgaagaagtaaggactgaggaaattgtttctacagatttagtcatcaataat
ctccaattttcatttgaagaaaataaaaaaatctttgataattttaatttagaagttaaa
caaggagaacatattgctcttttgggacgttcaggcgtgggtaaatcaacacttgccggt
ttaatcagaggagatttagttccccaaagtggaagtattcaattttctggtgttgagcca
tctaaagctaaaaatgttgaagaaaaaattggtgtcattaatcaatccccttatcttttt
gcgacaagccttcgttctaatttgactttggcgaaactcaatgccagtgatgctgaaatt
tgggaagctcttgaattcgttggcctccgtaaaatggttgaatcattacctcaaaaactt
ctgacaccagtagatgaagcgggagaacgattctctggtggagaacgtcaacgcttagcc
ttggcacgggttcttttatcagatgttgatgttgtaattcttgatgaaccaactgtatca
cttgacccaatcacagaaaatcaactcttaagtctcttttttgaacagctccgtgataaa
tcaattatttttattactcatcatttattaggtgttcatcatatggaccgagttctattt
ttagaaaatggctcgattaaatttgatgggaaacccgcgtcattactggagaataatcca
acatttaaggaactttatcaacttgatttaggaaatgaataa

DBGET integrated database retrieval system