KEGG   Lactococcus lactis subsp. lactis NCDO 2118: NCDO2118_0916Help
Entry
NCDO2118_0916     CDS       T03437                                 

Gene name
butB
Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
llx  Lactococcus lactis subsp. lactis NCDO 2118
Pathway
llx00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:llx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NCDO2118_0916 (butB)
Enzymes [BR:llx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NCDO2118_0916 (butB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NCDO2118_0916 (butB)
    1.1.1.-  
     NCDO2118_0916 (butB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C Pyr_redox_2 AlaDh_PNT_C HI0933_like FAD_binding_3 DAO RrnaAD Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AII12404
LinkDB All DBs
Position
953319..954389
Genome map
AA seq 356 aa AA seqDB search
MRAARFYDRGDIRVDEINEPIVKAGQVGIDVAWSGICGTDLHEFLDGPIFCPSAEHPNPI
TGEVPPVTLGHEMSGVVNFIGEGVSGLKVGDHVVVEPYIVPEGTDTSETGHYNLSEGSNF
IGLGGNGGGLAEKISVDERWVHKIPDNLPLDEAALIEPLSVGYHAVERANLSEKSTVLVV
GAGPIGLLTAAVAKAQGHIVIISEPSGLRRKKAQEAQVADYFFNPIEDDIQAKVHEINEK
GVDAAFECTSVQPGFDACLDAIRMGGTVVIVAIWGKPASVDMAKLVIKEANLLGTIAYNN
THPKTIDLVSTGKIKLDQFITAKIGLDDLIDKGFDTLIHHNETAVKILVSPTGKGL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcacgtttttacgaccgcggggatatccgcgttgatgaaattaatgaacca
atagtaaaagctggccaagttggcattgatgtggcttggagtggaatttgtggaacagat
cttcatgaatttttagatggcccaattttttgtccgtcagcagaacatcctaatccaatt
actggagaagtaccaccagtcactcttggacatgaaatgtctggggttgtaaattttata
ggtgaaggagtaagcggacttaaagtgggtgaccatgtcgttgtcgaaccttatatcgtt
cccgaagggactgatacaagtgaaactggacattataacctctcagaaggttcaaacttt
attggtttgggcggaaatggtggaggattggctgaaaaaatttctgttgatgaacgttgg
gttcacaaaattcctgataacttaccattggatgaagccgctctaattgagccactatca
gttggctatcacgctgttgaacgagcaaatttaagtgaaaagagtacggtattagttgtt
ggtgctggaccaattggactattaactgctgccgttgcaaaagcgcaaggacatattgtt
atcatcagtgaacctagtggacttcgtcgtaaaaaagcacaagaagcacaagttgctgat
tatttcttcaatccaattgaagatgacattcaagctaaagttcatgaaattaatgaaaaa
ggagtggacgcagcctttgaatgtacctctgtccaaccgggatttgacgcttgtctagat
gcgattcgtatgggtggaacagttgtcattgttgcaatttggggcaagcctgctagtgtt
gatatggcaaaattagtaatcaaagaagctaaccttttaggaacgattgcttataataac
actcatccaaaaacaattgatttagtatcaacaggtaaaataaaattggaccaattcatc
acagctaaaatcggtttggatgatttgattgataaaggattcgatacgctgattcatcat
aatgaaacagctgttaaaattttagtttcacccactggtaaaggtttataa

DBGET integrated database retrieval system