KEGG   Lactococcus lactis subsp. lactis NCDO 2118: NCDO2118_1280Help
Entry
NCDO2118_1280     CDS       T03437                                 

Gene name
amyL
Definition
(GenBank) Alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
llx  Lactococcus lactis subsp. lactis NCDO 2118
Pathway
llx00500  Starch and sucrose metabolism
llx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCDO2118_1280 (amyL)
Enzymes [BR:llx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     NCDO2118_1280 (amyL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AII12760
LinkDB All DBs
Position
1376193..1377668
Genome map
AA seq 491 aa AA seqDB search
MKTILQAFEWYLPSDSQHWNNIKENIPDLGKLGFSGLWLPPASKAASGVEDVGYGTYDLF
DLGEFDQKGTIPTKYGTKDEYLDLINTLHHNNIEVYADIVFNHMMGADETETIEADIKAE
DNHLHNIENNKTVEVWTKFTFPGRQGKYDNYIWTWHNFTGIDYDERKNQEEILEFEGHEW
DENVDSENNNFDYLMGADLDFSVSETVEQLEKWGHWFSEMTKIDGFRLDAIKHIDFKYFD
KWLEQRAKQLDKKLFIVGEYWSDDLGKLEYYLEQSGDKIQLFDVPLHFNMKEASSSNGEF
DMRTLFDHTLTASQPELSVTFVDNHDTQEGQALESWIPAWFKEHAYSLILLRKKGTPTVF
WGDLYGIHSRNVNPVGDNLRTMIALRKDSEFLRENDYFDHPDIIGWTNILKIDNKEYGLS
CILTNKNGGSKYMIIDKAYAGKVYIDLFGRHEIPITLDQNGGAEFYVNDGSVSVWVDKEI
VSKIDQMNFQN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatccttcaagcttttgaatggtatttaccctcagattctcagcactggaat
aatataaaagagaatattcctgacttaggaaagttaggattttcaggattgtggttacct
ccagcttccaaggcagcttctggagttgaagatgttggttatgggacctatgatttattc
gacttaggggaatttgatcaaaaagggacaattcctacaaaatatgggactaaagatgaa
tatcttgatttaattaatacactacaccacaacaatattgaagtgtatgcggatatcgtt
tttaatcacatgatgggtgctgatgaaacagaaactattgaagctgatattaaagcagaa
gataatcatcttcataacatcgaaaataataaaactgttgaagtttggaccaaatttaca
tttccaggaagacaaggaaaatacgacaattatatatggacctggcacaactttacggga
attgattatgatgaaaggaaaaatcaagaagaaattcttgaatttgaaggacatgaatgg
gatgagaatgtagattcagagaataataattttgattatttaatgggggctgatcttgat
tttagtgtttcggaaacggtagaacaacttgaaaaatggggacattggttttcagaaatg
acaaaaattgatggttttcgattagatgcaattaaacatattgatttcaaatattttgat
aaatggctcgaacagagagcaaagcaattagataaaaaactttttattgttggagagtac
tggtctgatgatcttggcaaattagagtattatcttgaacaatctggtgataaaatacaa
ttatttgatgtaccactacattttaatatgaaagaagcctcttcaagcaatggagaattt
gatatgcgtactctttttgatcacacactcactgccagccaaccagaactctcggtcact
tttgttgataaccatgatactcaagaaggacaggctcttgaatcttggattccagcttgg
tttaaagagcacgcttatagcttaattttacttcgcaaaaaaggaactcctactgtcttt
tggggagatttatatggaatacactcacgtaatgttaatcctgtaggtgataacttgaga
actatgatagcattgcgtaaggactctgagtttttaagggaaaatgattattttgatcat
cctgatattattggatggacaaatattttaaaaatagataataaggaatatggattatca
tgtattttaactaataaaaatggtggctcaaaatatatgataattgataaggcgtatgca
ggtaaagtttatatagatttatttggaagacatgaaatacctattacgctggatcaaaat
ggtggagctgaattttatgtcaatgatggaagtgtttcggtttgggtagataaggagatt
gtttcaaaaattgatcaaatgaactttcaaaactaa

DBGET integrated database retrieval system