KEGG   Lactococcus lactis subsp. lactis NCDO 2118: NCDO2118_1319Help
Entry
NCDO2118_1319     CDS       T03437                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
llx  Lactococcus lactis subsp. lactis NCDO 2118
Pathway
llx00250  Alanine, aspartate and glutamate metabolism
llx00430  Taurine and hypotaurine metabolism
llx00650  Butanoate metabolism
llx01100  Metabolic pathways
llx01110  Biosynthesis of secondary metabolites
llx01120  Microbial metabolism in diverse environments
llx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:llx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NCDO2118_1319 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCDO2118_1319 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCDO2118_1319 (gadB)
   00430 Taurine and hypotaurine metabolism
    NCDO2118_1319 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NCDO2118_1319 (gadB)
Enzymes [BR:llx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NCDO2118_1319 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AII12798
LinkDB All DBs
Position
complement(1422562..1423962)
Genome map
AA seq 466 aa AA seqDB search
MLYGKENRDEAEFLEPIFGSESEQVDLPKYKLAQKSIEPRVAYQLVQDEMLDEGNARLNL
ATFCQTYMEPEALKLMSQTLEKNAIDKSEYPRTTEIENRCVNMIADLWNACEKEKFMGTS
TIGSSEACMLGGMAMKFSWRKRAEKLGLDINAKKPNLVISSGYQVCWEKFCVYWDIEMRE
VPMDKEHMSINLDKVMDYVDEYTIGVVGIMGITYTGRYDDIKALDNLIEEYNKQTDYKVY
IHVDAASGGLYAPFVEPELEWDFRLKNVISINTSGHKYGLVYPGVGWVLWRDKKYLPEEL
IFKVSYLGGELPTMAINFSHSASQLIGQYYNFVRYGFDGYKAIHERTHKVAMFLAKEIEK
TGMFEIMNDGSQLPIVCYKLKENSNRGWNLYDLADRLLMKGWQVPAYPLPKNLENEIIQR
LVIRADFGMNMAFNYVQDMQEAIEALNKAHILYHEEPENKTYGFTH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttatacggaaaagaaaatcgcgatgaagcagagttcttggaaccaatttttggttca
gaaagtgaacaagtggatttgcctaaatataaattagctcaaaaatcaattgagcctcga
gtggcctatcagttagttcaagatgaaatgttagatgaagggaacgctcgtttaaattta
gccacattctgtcaaacttatatggaacctgaagcactcaaactaatgagtcagaccttg
gaaaaaaatgcgattgataaatcggaatatccaagaacaactgaaattgagaaccgttgc
gtcaacatgatcgctgatctttggaatgcgtgtgaaaaagaaaaatttatggggacttca
acgattggttcttcagaagcttgtatgcttggtggaatggccatgaagttttcttggcgc
aagcgagcagaaaaattgggattagatattaatgcgaaaaagccaaacttagttatttca
tctggttatcaagtttgctgggaaaaattctgtgtttattgggatattgaaatgcgagaa
gtgccaatggataaagaacatatgtcaatcaatttggacaaggtgatggattatgttgat
gagtacacgattggtgtagttggtattatggggattacttatactggtcgttatgatgat
atcaaagctttggataatttgattgaagaatataataaacagacagattacaaagtttat
attcacgtagatgctgcttcaggaggactttatgctccctttgttgagccagaacttgag
tgggatttccgtttgaaaaatgtcatttcaatcaatacctcaggccataaatatggttta
gtttatcctggtgtaggttgggttttgtggcgtgacaaaaaatatttaccagaagaatta
atttttaaagtaagttatcttggaggagaactaccaacgatggcgattaatttttctcac
agtgcctctcaattaattggtcaatattataattttgtacgttatggatttgatgggtat
aaagctattcatgaaagaacgcataaagtcgccatgtttttagcaaaagaaattgaaaaa
actggaatgtttgaaattatgaacgatgggtcacaattgccaattgtttgctacaaatta
aaagaaaattcaaatcggggttggaatctttatgatttggcggaccgtttattaatgaag
gggtggcaagtgcctgcttatccacttcctaagaatttggaaaatgaaatcattcaacgt
ttagtgattcgagcagattttgggatgaatatggcatttaactatgttcaagatatgcaa
gaagcaattgaggctttaaataaggctcatattctataccatgaggaacctgaaaataaa
acatatggctttactcactaa

DBGET integrated database retrieval system