KEGG   Lactococcus lactis subsp. lactis NCDO 2118: NCDO2118_1386Help
Entry
NCDO2118_1386     CDS       T03437                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
llx  Lactococcus lactis subsp. lactis NCDO 2118
Pathway
llx00010  Glycolysis / Gluconeogenesis
llx00030  Pentose phosphate pathway
llx00051  Fructose and mannose metabolism
llx00052  Galactose metabolism
llx00680  Methane metabolism
llx01100  Metabolic pathways
llx01110  Biosynthesis of secondary metabolites
llx01120  Microbial metabolism in diverse environments
llx01130  Biosynthesis of antibiotics
llx01200  Carbon metabolism
llx01230  Biosynthesis of amino acids
llx03018  RNA degradation
Module
llx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:llx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCDO2118_1386 (pfkA)
   00030 Pentose phosphate pathway
    NCDO2118_1386 (pfkA)
   00051 Fructose and mannose metabolism
    NCDO2118_1386 (pfkA)
   00052 Galactose metabolism
    NCDO2118_1386 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    NCDO2118_1386 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    NCDO2118_1386 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:llx01009]
    NCDO2118_1386 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:llx03019]
    NCDO2118_1386 (pfkA)
Enzymes [BR:llx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NCDO2118_1386 (pfkA)
Protein phosphatases and associated proteins [BR:llx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NCDO2118_1386 (pfkA)
Messenger RNA biogenesis [BR:llx03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NCDO2118_1386 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AII12864
LinkDB All DBs
Position
complement(1501063..1502085)
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDK
IGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMGRNAGDIALNA
GIAAGADDICIPEKEFKFENVVNNINKGYEKGKNHHIIVLAEGVMTGEEFATKLKEAGYK
GDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGIRNEELVESPILGT
AEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNLN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcagttttgacttctggtggtgatgccccaggaatgaatgcggctatt
cgtgcagttgttcgcaaagcaatttctgaaggtatcgaagtttacggtatcaatcacgga
tatgcgggcatggttgcgggagatattttcccgcttacgtcagcttcagttggtgataaa
atcggtcgtggtggtacattcttgtattcagcacgctacccagaatttgctcaagtagaa
ggacaacttgctgggattgagcaacttaaaaaattcggtatcgaaggtgtcgttgtaatc
ggtggtgatggttcttatcatggagctatgcgtcttacagaacatggtttcccagctgtt
ggacttccaggaacaatcgataacgatatcgtaggaactgattttacaattggatttgat
acagctgtttcaacagttgtagatgccttggataaaatccgtgatacttcatcatcacat
aaccgtactttcgttgtagaagtaatgggacgtaatgctggagatatcgctttgaatgct
ggtatcgctgctggtgcagatgatatttgtattccagaaaaagaatttaagtttgaaaac
gtagttaacaacattaacaaaggctacgaaaaaggtaaaaatcaccacatcatcgttctt
gctgaaggtgtaatgactggtgaagaatttgctacaaaacttaaagaagctgggtataaa
ggagatcttcgcgtttctgtccttggacacatccaacgtggtggttcaccaacagctcgt
gaccgtgttcttgcttcacgtatgggtgctcgtgccgttgaattgcttcgtgatggaatc
ggtggcgtagccgttggtatccgtaatgaagaacttgtagaaagtccaattctcggaaca
gctgaagaaggagcactctttagtttgactactgaaggtggaatcaaagtaaataacccg
cataaagctggtcttgaactttaccgtcttaactcagcactcaacaatcttaaccttaac
taa

DBGET integrated database retrieval system