KEGG   Leishmania major: LMJF_12_0630Help
Entry
LMJF_12_0630      CDS       T01014                                 

Gene name
ALAT
Definition
(RefSeq) alanine aminotransferase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
lma  Leishmania major
Pathway
lma00220  Arginine biosynthesis
lma00250  Alanine, aspartate and glutamate metabolism
lma01100  Metabolic pathways
lma01200  Carbon metabolism
lma01210  2-Oxocarboxylic acid metabolism
lma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMJF_12_0630 (ALAT)
   00220 Arginine biosynthesis
    LMJF_12_0630 (ALAT)
Enzymes [BR:lma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LMJF_12_0630 (ALAT)
Amino acid related enzymes [BR:lma01007]
 Aminotransferase (transaminase)
  Class I
   LMJF_12_0630 (ALAT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Ribonuc_red_lgN
Motif
Other DBs
NCBI-GeneID: 5649953
NCBI-ProteinID: XP_001681668
GeneDB: LmjF.12.0630
UniProt: Q4QGN0
LinkDB All DBs
Position
12:343177..344670
Genome map
AA seq 497 aa AA seqDB search
MLRHAARCFSPRQCYVSPRVMEAEYAVRGLIPARADEIKADLATGHGTYSFESLVYCNIG
NPQSVGQMPLTFYRQVMVLVDAPFLLEDAEIVARLPEDAVARARRYLSEIGTGTGAYTES
FGFRFARAAVAAHINELDHGVSPAATVNDICLTDGASMGAKLFLQLLVGGASDAVMIPVP
QYPLYSAQIALLGGVKVPYGLHESEGWVMKLSDLVAAYERCVTESGATPRLFVCINPGNP
TGNVLERCVMEDVVRFCHERGMLLLADEVYQENVYDTRRRFLSFREVVLGMPEPYCSETM
LVSLHSTSKGVIGECGRRGGYFCMTNLPAALRQQVVKLCSINLCANVNGQLMTALMCSPP
REGEASYALHRREYDEIFTGMKERAELLARELGAVRGLSCQPVEGAMYAFPRIVLPERYA
QRNEELNAKEGRQLALDARWALELLESSGIVVVPGSGFGQEPGTLHFRITILPPLEQIDR
MVRAIREFQDRIYEQYA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccacgctgctcgttgcttttcaccaaggcaatgctacgtaagccctcgcgtc
atggaggcggaatacgccgtgcgggggctgatcccggcgcgcgcggatgagatcaaggcg
gacttggctacaggccacggcacctactcgttcgaaagcctcgtgtactgcaacatcggc
aacccgcagtcagtggggcagatgccgctaacgttctaccgacaagtgatggtgctcgtc
gatgcgccgttcctgctggaggatgcggaaatcgttgcgcggctgccagaggacgccgtt
gcacgcgcgcgcaggtacctttcggagatcgggacgggcaccggcgcgtacacagagtct
ttcggcttccggtttgcccgcgctgccgttgcggcgcacatcaacgagctcgaccatggc
gtgagcccggctgcgacggtgaacgatatctgtctgacagacggcgcgagcatgggtgcg
aagctgttcctgcagctccttgtgggcggcgcgagcgatgctgtgatgatcccggttccg
cagtatccgctatactctgcgcagattgctttacttggcggggtgaaggtgccctacggc
ctgcacgagtctgaggggtgggtaatgaagttgtcggaccttgttgccgcgtacgagcgg
tgcgtgaccgagagcggcgcgacgccgcgcttgtttgtgtgcatcaaccccgggaacccg
acggggaacgtactggagcgctgcgtgatggaggacgtcgtgcggttctgccacgagcgc
ggcatgctgctgcttgcagacgaggtgtaccaggagaacgtgtacgacacgcgacgccgg
tttttgagcttccgcgaggttgtgcttgggatgcctgagccgtactgctcggagacgatg
cttgtgtcactgcactcgacatcgaaaggggtgattggtgaatgcgggcggcgcggcggg
tatttctgcatgacgaacctgcctgctgcgctgcgccagcaggttgtgaagctgtgctcg
atcaacctgtgtgcaaacgtgaacgggcagttgatgactgcgctgatgtgctcgccgccg
cgcgagggcgaagcgagctacgcgctgcaccggcgcgagtacgacgagatctttacgggc
atgaaggagcgcgctgagctgctggcgcgcgagcttggggctgtgcgcgggctctcgtgc
caaccggtggagggcgcaatgtacgcgttcccgagaattgtgttgcctgagcggtacgcc
cagcggaacgaggagctgaacgcgaaggagggtcggcagcttgcgctggacgcgcggtgg
gcgctggagctgctggagtcgagcgggatcgttgttgtgcccgggtctgggttcgggcag
gaacccgggacgctgcactttcggatcacgattctcccgcctcttgaacagattgatcgg
atggtgcgtgcgatccgcgagttccaggaccggatctacgagcagtacgcttaa

DBGET integrated database retrieval system