KEGG   Leishmania major: LMJF_23_0790Help
Entry
LMJF_23_0790      CDS       T01014                                 

Definition
(RefSeq) hypothetical protein
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
lma  Leishmania major
Pathway
lma00310  Lysine degradation
lma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    LMJF_23_0790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lma03036]
    LMJF_23_0790
Enzymes [BR:lma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     LMJF_23_0790
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     LMJF_23_0790
Chromosome and associated proteins [BR:lma03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     LMJF_23_0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SET zf-MYND zf-Mss51 DUF5526 VATC
Motif
Other DBs
NCBI-GeneID: 5652063
NCBI-ProteinID: XP_001683414
GeneDB: LmjF.23.0790
UniProt: Q4QB84
LinkDB All DBs
Position
23:complement(394158..396728)
Genome map
AA seq 856 aa AA seqDB search
MDSCVSLTYSSKEEAGRHAVARRHLSPGELVLAAAPFGLVMNPNYCPSALYLSSKATAKS
DAATGVSSAEPGGKTAKKAGGGHGCDNRANNAAAASAAGESASASHHAHTLKDEAGVQGE
VSPTSTSRWYTTTPTWCSVCFQEIPAGRWLCNRWSLTELAMDIAQEQEELDRSIRVAEAR
APGSDKVNRGDEGGDDAASAAAAAALRKLRKPSKSSETRKHGAVELKQRLLEKALALREE
LLLRRRQRRRRVEEELPVLRREGWETSTSSSSFAAGAAYGEPAMSGCAGCGVLCFCSEAC
WRAHRDEHEQSGECALLRSLYPRLMAAYYTMGVVSSSASTGGACSTVVMPGDEPLHWARS
TSEPRMLEFQSLLFSAIVVARACRAGYQARCAAAAEDAAVRLEGGVAAQVVAPSAADGGS
ASVEAKSQANTLDEQSLLPTSPSAVSGRGEQRSSDTLVASSTSTTVDSVAIPKEVRLINE
IRAKAGLAGTVEVLDADPELRRFARGVSEPRDHSSTEGLPDISSDSPAADPCAVRTTNAA
RVCSCASVSTTRGGADHDPLPQLRTRTPQYADLAQMETNLSVISKHNRSTYQRYYRAFAK
RVLPVLQQLLLHQQRGVTVGVSDGDSCVDAASRPLAHPEEGTGDVLQVSEVYFQRLCAAV
QCNSFGVYDTQDHCIGFGIYPEASYFNHSCVPNLCRVMHHGSRIAAFYALRAIAAQEPLT
ICYTDVEQLNSAERRRNLLSTYRFFCMCERCSGKAEGPQMAIAAAGNCESVSGPCSGCVE
VSPGAFENPLLLCAECPIHGYLRPLPPPFYSSSPAKSDSSPTWTPSWTMQEVKMRECTVC
RSRVVREAVAAAATLQ
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggacagctgtgttagcctcacctacagctcgaaagaggaagcgggccggcacgctgtg
gcacgacgtcatctctctcccggcgaactcgtgctcgctgcggcgccgtttgggctcgtc
atgaacccaaattactgccccagcgccctctacctctcctccaaagccaccgcgaagtca
gatgcggcaaccggtgtctcaagcgcagaaccgggtggcaagacggcgaagaaggcagga
ggagggcatggctgtgataatcgagcgaacaacgcggccgcggcatcggcagcgggcgaa
tcggcgtctgcgtcgcaccacgcgcatacactgaaggacgaggctggcgtgcagggcgag
gtgtcgccgacgagcacctctcgctggtacactacgacgccgacgtggtgctccgtgtgc
tttcaagagatccctgcaggccggtggctgtgcaaccgttggagcctcaccgagctggca
atggacattgctcaggagcaagaggagcttgaccgaagtatcagggtcgccgaggcacgg
gcccctggctctgacaaagttaacagaggcgacgagggcggcgacgacgcggcctccgca
gctgcagcagcggcgctccgcaagttgaggaagccgtccaagtcttccgagacccgcaag
catggcgcggtggagctaaagcagcgtttgctcgaaaaggctcttgcgctgcgggaggag
ctcctcttgcggcggcggcagcgtcgtcgtcgtgttgaggaagagctgccggtgctgcgc
cgcgaagggtgggagacgtcgacatcatcctcgtctttcgcggcgggagcggcgtatggc
gagccggccatgtctggctgcgccggctgtggggtcctctgcttctgctccgaggcgtgt
tggcgcgcccatcgcgacgagcacgagcagagcggcgaatgtgccttgctgcggtctctg
taccctcggctcatggctgcgtactacacgatgggcgtggtcagctcttcggcaagcacc
ggcggcgcgtgcagcactgtggtgatgccgggggacgaaccactgcactgggcacggtcg
acaagcgagccgcgaatgcttgagtttcagtcgctgctcttcagtgccattgtggtggca
cgtgcgtgccgtgccgggtaccaggcacgctgcgccgctgcagctgaggatgccgctgtg
cgcttggagggcggcgtcgcggcgcaggtggtagcgccctccgctgctgatggcggttca
gcttctgtcgaagctaaatcgcaagccaacaccttggacgagcaatcgctgctgcctaca
agtcccagcgcggtgtcgggccgaggtgagcagcgcagctcagacacgctggtggcaagc
tccacctcaacaacggtggactcggtggccattcccaaggaggtgcggttgattaacgag
attcgcgccaaggcgggtctggcaggcacggtggaggtgctcgacgctgaccctgagctg
cgacgctttgctcgtggggtatcggaaccgagagaccactcaagcactgaagggctgccg
gatatctccagcgactcacctgctgcggacccgtgtgccgtcagaacgacgaatgcggca
cgggtgtgcagctgtgccagcgttagcaccaccaggggcggtgccgaccacgaccctctt
ccgcagctccgtacacgaactccgcaatacgcggacttggctcagatggagacaaacttg
tccgtcatctcgaagcataatcgcagcacataccagcgttactaccgtgccttcgcgaag
cgggtgctgccggtgcttcagcagcttctgcttcaccaacagagaggcgtcaccgtcggc
gtcagtgacggtgacagctgtgtggatgcagcatcgcggccgttggcgcatccggaagag
ggcactggcgacgtgctgcaggtatcggaggtgtactttcagcgactgtgcgcggctgtg
cagtgcaacagtttcggtgtctatgatacgcaggaccactgcatcggtttcggcatatac
ccagaggcatcgtactttaaccactcctgcgtgccgaacttgtgccgcgtcatgcatcat
ggcagccgcatcgccgctttctacgcactgcgcgctattgcggcacaggaaccgctgaca
atttgctacacagatgtggagcagctgaacagtgccgagcggcgccggaatctgctcagc
acttaccgcttcttctgcatgtgtgagcgatgcagcggaaaggctgaggggccgcagatg
gcgatcgccgccgcaggcaactgcgagagtgtcagcggcccgtgctccggctgtgtggag
gtttcgccgggggccttcgagaacccactgctgttatgtgctgagtgcccgattcacgga
tatctgcgtccgctgcctccaccgttttatagctcctcgcctgcgaagtctgactcttcc
cccacatggacaccgtcgtggaccatgcaggaagtgaagatgcgggagtgcacggtgtgc
cggtcacgagtcgtgcgcgaagctgtggctgctgcagcgacgcttcagtga

DBGET integrated database retrieval system