KEGG   Leishmania major: LMJF_24_1630Help
Entry
LMJF_24_1630      CDS       T01014                                 

Definition
(RefSeq) putative succinate dehydrogenase flavoprotein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lma  Leishmania major
Pathway
lma00020  Citrate cycle (TCA cycle)
lma00190  Oxidative phosphorylation
lma01100  Metabolic pathways
lma01110  Biosynthesis of secondary metabolites
lma01130  Biosynthesis of antibiotics
lma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LMJF_24_1630
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LMJF_24_1630
Enzymes [BR:lma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LMJF_24_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 5652330
NCBI-ProteinID: XP_001683680
GeneDB: LmjF.24.1630
UniProt: Q4QAG8
LinkDB All DBs
Position
24:610671..612494
Genome map
AA seq 607 aa AA seqDB search
MLRRTFTRLALSRAYPVIDHTYDCVVVGAGGSGLRAAMGVAASGYDVACISKLYPSRSHT
IAAQGGINAALANCEEDDWRWHVYDTVKGSDWLGDQDAIHYMCQEAPCVVSELESMGLPF
LRTKDGFIYQRAFGGQSIHYGGKQARRTCAASDRTGHAMLHTLYGQSFQYGVNFYNEYYC
LDLIMEDGCCRGVMAMSIDDGTIHRFKSKYTVLCTGGYGRVYFTTTSAKSCTGDGTAMVA
RAGLPAEDMEFVQFHPTGIYGPGVLITEGARGEGGYLVNSEGERFMERYAPKAKDLASRD
VVSRAITMEILAGRGCGPKKDHVMLQLHHLDPATLHKKLPGISESAHIFAGVDVTKEPIP
IVPTVHYSMGGVPTLWTGEVVSPRNGDDNAIVPGLLAAGECACASVHGANRLGANSLLDI
VVFGKSCANTVIFNLTKEGRKQPELRADAGEASIADLDRILTNKGDIPIARIRERMKETM
ALYAAVFRTEENMQTGKKIIEECYRDFSHAFVHDKSPVWNSNLIEALELRNLLTNAMMTI
SGAVVRKESRGAHARDDYQERDDHNWMKHTLAYLDDANGKVRLAYRPVHMEMLTNEVESI
PPAKRVY
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcacctttacgcgtcttgcccttagccgcgcctacccggtcatcgaccac
acgtacgactgcgtcgtcgtgggcgccggtggctctggtctccgcgcggccatgggtgtg
gcggcctctggctacgatgtggcgtgcatctcgaagctgtacccgtctcgctcgcacacg
atagcggcgcagggtggcattaacgctgctctcgccaactgcgaggaggatgactggcgc
tggcatgtatacgacacagtaaagggctcggactggcttggcgaccaggatgcaatccat
tacatgtgccaggaggccccatgcgttgtgtcggagctggagagcatgggtctgcccttc
ctgcgcacaaaggatggcttcatctaccagcgcgcctttggtggccagtcgatccactac
ggtggcaagcaggcgcgccgcacctgtgcggcgtcggaccgcacgggccacgccatgctt
cacaccctgtacggccagtccttccaatacggcgtgaacttttacaacgaatactactgc
ctcgatctgatcatggaggatggctgctgccgcggtgtgatggccatgagcatcgacgat
ggcacgatccaccgcttcaagtccaagtacacggtgctctgcacgggtggctacggccgc
gtatacttcacgacgacaagcgcgaagagctgcacaggcgacggcacggccatggtggcg
cgcgccggtctgccggcggaggacatggagtttgtgcaattccatcccaccggcatctac
ggccctggcgtgctcatcaccgagggcgcgcgcggcgagggtggctaccttgtgaacagc
gagggtgagcgcttcatggagcgctacgcccccaaggcgaaggatctggcgtcgcgcgat
gtcgtgtcgcgggccattacgatggagatcctagcgggtcgcggctgcggtcccaagaag
gaccacgtgatgctgcagctacaccacctcgaccctgccactctgcataagaagctgccg
ggcatctcagagagcgctcacatcttcgccggcgttgacgtgaccaaggagccgattccg
attgtgccaacggtgcactactccatgggcggcgtgccgacactgtggacgggcgaggtg
gtcagcccgcgcaacggtgacgacaacgcgattgttcccggccttctcgcagctggtgag
tgcgcctgtgctagcgtgcacggcgccaaccgcctcggcgcgaactcgctgctggacatt
gtcgtgttcggcaagtcgtgtgccaacacggtcatctttaatctgacgaaggagggccgc
aagcagcccgagctgcgcgccgacgccggcgaggcctcgatcgccgatctggaccgcatc
ctcactaacaagggcgacattcccatcgcccgtatccgtgagcgtatgaaggagacgatg
gcgctctacgccgccgtcttccgcacagaggagaacatgcaaacaggaaagaagataatc
gaggagtgctaccgcgacttctctcacgccttcgtgcacgataaatcgccggtgtggaac
agcaacctcatcgaggcgctcgaactgcgcaacctgctgacgaacgctatgatgacgatt
agtggcgctgtggtgcgcaaggagagccgcggtgcccacgcacgtgacgactaccaagag
cgtgacgaccacaactggatgaagcacactctcgcatacctcgacgacgccaacggcaag
gtgcgccttgcgtaccgcccggtgcacatggagatgctgacgaatgaggtggagagcatt
ccgccggcgaagcgagtgtactag

DBGET integrated database retrieval system