KEGG   Leptospira mayottensis: DPV73_00270Help
Entry
DPV73_00270       CDS       T05598                                 

Definition
(GenBank) hypothetical protein
Organism
lmay  Leptospira mayottensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_1 CSTF_C DUF2322 LRR_6
Motif
Other DBs
NCBI-ProteinID: AXR66691
UniProt: A0A3B6Z268
LinkDB All DBs
Position
I:41676..43175
Genome map
AA seq 499 aa AA seqDB search
MKITNLQKIGTLIFLCLGALILLCFLDLCEAEEKGTYHNLTEALQNPTDVLILDLIGNQL
TTLPKDIGQLQNLQKLDLRGNRIAILPKEIGYLKELQKLDLSNNQLTTLPKDIEQLQKPL
VLHLNYNNFTTLPKEIGKLKELQGLELYNNQLKTLPKDIERLQNLQVLNLGDNQLTTLPN
KIGKLQNLQVLRLGNNKLTILSKEIGKLQNLQVLNLTNNQLKTLPKDIGHLKELQDLDLS
HNKLTILSKEIGKLQNLQVLDLSGNQLTTLPKDIGYLKELQVLHLEDNQFTALPKDIGQL
QNLRVLYLYNNQLTILPKEIGELQNLQVLYLHSNQLTTLPKEIGHLKGLQELYLSNNQLT
TLPKDIGELQNLQVLYLHSNQLTTLPKEIGQLQNLPVLYLSYNQLTSLPKDIGKLQNLQK
LDLSNNQLTTLPNEIGKLQNLQELYLSNNKLKTLPDDIGKLQKLRTLDLDDIPALRSQKE
KILKLLPKIHHVNFIKITK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacgaacttacaaaaaataggaactttaatctttctttgcttaggagcttta
atccttctttgctttttagacctatgcgaagccgaagaaaaaggaacctatcacaatcta
accgaggctcttcaaaatccaacggatgttctaattttagatttaataggcaatcagctc
acaactcttccaaaagatatcggacaactgcaaaacctacaaaaattggatttaagaggc
aatcgaatcgcaattcttcccaaagaaatcggatatttgaaagaactacaaaaattggat
ttaagcaacaatcaactcacaactcttccaaaagatatcgaacaattgcaaaaaccacta
gtattacatttaaactacaacaattttacgacactccccaaagaaatcggaaagttaaaa
gaactacaaggattagagttatataacaatcaactcaaaactcttccaaaagatatcgag
cgattacaaaacctacaagtattaaatttaggcgataatcaactcacaactcttcccaat
aaaatcggaaaattacaaaacctacaagtattacgtttaggaaacaacaaactcacaatt
ctttctaaggaaatcggaaaactacaaaacctacaagtattaaatttaaccaacaatcaa
ctcaaaacgcttccaaaagatatcgggcatttgaaagagctacaagacttagatttaagc
cacaacaaactcacaattctttctaaagaaatcggaaaattacaaaacctacaagtatta
gatttaagcggcaatcaactcacaacgcttcctaaagatatcggatatttgaaagaacta
caagtattacatttagaagacaatcaattcacggctcttccaaaagatatcggacaactg
caaaacctgcgagtattatatttatataacaatcagctcacaatacttccgaaagaaatc
ggggaattgcaaaacctacaagtattatatttacatagcaatcagctcacaacgcttccg
aaagaaatcggacatttgaaaggactacaagaattatatttaagcaacaatcaactcaca
acgcttccaaaagatatcggggaattgcaaaacctacaagtattatatttacatagcaat
cagctcacaacgcttccgaaagaaatcgggcaactacaaaacctaccagtattatattta
agctacaatcaactcacaagccttccaaaagatatcggaaaattacaaaacctacaaaaa
ttagatttaagcaacaatcaactcacaactctcccaaatgaaattggaaaattgcaaaac
ctacaagaactatatttaagcaacaacaaactaaaaactcttccggatgatattggaaaa
ttgcaaaagctgcgaacattagatttagatgatatacctgctttgaggtctcaaaaagaa
aagattctaaaattacttcccaaaatacatcatgttaactttatcaaaataacaaagtaa

DBGET integrated database retrieval system