KEGG   Leptospira mayottensis: DPV73_06775Help
Entry
DPV73_06775       CDS       T05598                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lmay  Leptospira mayottensis
Pathway
lmay00970  Aminoacyl-tRNA biosynthesis
lmay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmay00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DPV73_06775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lmay03029]
    DPV73_06775
Enzymes [BR:lmay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DPV73_06775
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DPV73_06775
Mitochondrial biogenesis [BR:lmay03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DPV73_06775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AXR67761
LinkDB All DBs
Position
I:1439157..1440617
Genome map
AA seq 486 aa AA seqDB search
MVEFETIIGLEVHAQLNTESKIFSTSATKFGSPPNSQTNPVCLGLPGALPVLNESVLEKA
IMAGIAFGCDIALFTKFDRKNYFYPDLPKGYQISQFDKPICTGGGVTFTIKGEESPRYVR
LTRIHMEEDAGKLIHSADPNIPQSYVDLNRAGTPLIEIVSEPDMRSSDEAYYYLNSLKSI
LKYIRVSDCNMEEGSLRCDANVSIRPKGSDKFGTRVEIKNLNSFKAVKAAIDYEVEWQTE
MALEGKTFQQQTKLWDGVANKTVTMRTKEMSHDYRYFPDPDLPVVILQKETVESVRSKLP
ELPNERKNRFIEKLGLPKYDAEVLTAEREIADYFEDALKVSGDAKKTSNWVKDEVLGVVN
KESITISEFSVSAQRIGGLVKLIADGKISGKIAKTVFEELLTSDKNAEAIVVEKNLTVVR
DDKEIERIVDEAIANNQDAVAKYKSGKDRALGAIVGYVMKVSKGKADPELVNQMLLDKLG
PLPPKG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
ttggtggaatttgaaacgatcatcgggctggaagttcatgcacagctcaatacggaatcg
aaaatattctctacaagtgcgaccaagttcggttctcctcctaactcacaaaccaatccg
gtttgtttgggattgccgggtgcacttccggttctcaacgagtctgttttggaaaaagct
atcatggcggggattgcgttcgggtgtgatatcgctttatttactaaattcgatcgtaag
aattatttttatccggacctcccaaaaggttatcagatctctcaattcgataaacctatc
tgtactggaggcggggtcacttttacaatcaaaggggaagaatcccctcgttatgtgaga
ctgactcggattcatatggaagaagatgcgggaaagctgatacattccgcggacccgaac
attcctcagtcctatgtcgatctaaatagagcaggaactcccctcatcgaaattgtttcg
gaaccggacatgcgttcttcggatgaggcatattattatcttaattctttaaagtcgatt
ttaaaatatattcgcgtttcggattgtaacatggaggaaggttctcttcgttgcgacgca
aatgtttcgattcggccgaaaggttcggataaattcggaaccagagtcgaaattaagaat
ctgaattctttcaaagcagtcaaagcggcaattgattacgaggtagaatggcaaactgaa
atggcgttggaaggaaaaacttttcaacaacagactaaactctgggatggcgtggcaaat
aaaaccgtaacgatgagaaccaaagagatgagtcatgattatcgttattttcccgacccg
gatctgcccgtagtcattcttcaaaaagaaacggtagaatctgttcgttccaaattaccc
gaacttcccaacgaaagaaaaaatcgttttatagaaaagttagggcttccaaaatacgat
gccgaagttctgactgccgaaagggaaattgcggattactttgaagatgctttgaaagtt
tctggggatgcaaagaaaacgtccaactgggtcaaagacgaagttcttggcgtagtaaat
aaagaaagtattacgatttctgaattctctgtttctgcccaaagaatcggtggactcgta
aaattaattgcggatggaaaaatttcaggaaaaatcgccaagacggtttttgaagaactt
cttacttctgataaaaatgccgaagcgatcgtcgttgaaaaaaacctaactgtggtccga
gacgataaggaaatcgaaagaattgtggacgaggcgatcgctaataatcaggatgccgtg
gccaaatacaaaagtggtaaagatcgcgcgttaggcgctattgtaggttatgtgatgaaa
gtttccaaaggaaaagcggatcctgaattagtgaaccaaatgcttttggataaattggga
cctcttccgccaaagggttaa

DBGET integrated database retrieval system