KEGG   Leptospira mayottensis: DPV73_14075Help
Entry
DPV73_14075       CDS       T05598                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lmay  Leptospira mayottensis
Pathway
lmay00564  Glycerophospholipid metabolism
lmay01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmay00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DPV73_14075
Enzymes [BR:lmay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DPV73_14075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 FAD_binding_3 NAD_binding_8 Thi4 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AXR68966
LinkDB All DBs
Position
I:complement(2957402..2959054)
Genome map
AA seq 550 aa AA seqDB search
MQICRGKETCKAGRVLKMEKQNRTEQILKLQKESLDILIIGGGSTGTGAAFDAAKRGYKT
ALIEKKDFASGTSSRSTKLIHGGVRYLAQFHFKLIHEALTERQRLLENAPHLVKPLKFLL
PAYRFYERPYYGIGLTLYDILASKGKLPSHKTVSKSEAVSEFAAIKKEGLFGGITYYDAQ
FNDARLNVLLARSAKKEGAIVANRVELISFIKENGKLMGANLKDLETGKNFPVYAKVIAN
TTGIWVDHVRKLDDPRAFNVLSPSQGIHLVFSKKKIPCQSAIIIPKTKDGRVVFIIPWED
HVILGTTDTPIENPGDEPLPIGNEVQFLLDTGNEYLENPVTEKDILSVFAGIRPLISPEG
NQDTKNISREEVILVSNSGLVTMGGGKWSTYRKMAEDLVDKLIQVGNLETRKECSTKSYL
YPGAEGYSEPLYQEIEKMYKIDAQFAKRLQNYYGTEVFEILGKKPKLLGKGIPYFEEEVL
FAAKEEFALGVTDVLARRFRVLFVDLDLAKKMIEPVANILSKQLKWNNKTKKTEESATLE
LIESLKNSYR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttgtagggggaaagaaacctgtaaagcaggaagagttctcaaaatggaaaaa
caaaaccgaaccgaacaaattttgaaattacaaaaagaatccttggacattcttataatc
ggaggtggatccaccggaactggagctgccttcgacgccgcgaaaagaggttataaaaca
gcccttatagaaaagaaagattttgcctcgggaacttcttcccgttctaccaaactgatt
catggaggagtccgctatctggctcaatttcatttcaaattgatccacgaagctctgaca
gaaaggcaaagacttttggaaaacgcacctcacttagtaaaacctcttaagttcttactt
cccgcgtatcgtttttacgaaaggccttattatggaatcggcctcactctctatgatata
ctcgcttctaagggaaaacttccctctcataaaaccgtttccaaatccgaagccgtttcc
gaatttgcagcgatcaaaaaagaaggtctcttcggaggaatcacatactacgacgctcaa
ttcaacgacgcccgtttgaacgttctacttgcaagatccgcaaaaaaagaaggagccatt
gtcgccaatcgagtcgaactcatttccttcatcaaggagaatggaaaactcatgggtgcc
aatctcaaagatttggaaaccggaaagaactttccagtctatgcaaaggtaattgctaat
acgacgggaatttgggtggatcacgtccgtaagctcgatgatccaagagcatttaacgtt
ctttctccgagccagggaatccatcttgtcttttctaaaaaaaagattccctgccaatcg
gcgataatcattccaaaaacaaaagacggaagagttgtctttatcattccttgggaagat
cacgtgattttaggaacaacggatactccaattgaaaatccgggagacgaacctcttcca
atcggaaacgaggttcaattcctactcgataccggaaacgaatatctggaaaatccagtt
accgaaaaagatattctttccgtgtttgcggggattcgtcctttgatttctccggaagga
aatcaggatactaagaatatttcgagagaggaagttatcctcgtctccaattcaggcctt
gtcacaatgggcgggggaaaatggtctacttacagaaagatggctgaagatctagtagat
aaactaattcaagtcggtaatttagaaacccggaaagaatgttctacgaaatcttatttg
tatccaggggccgaaggttattcagaacctctctatcaagaaattgaaaaaatgtataag
attgatgcacaattcgccaaaaggttacagaactattatgggacggaagtttttgagatc
ttaggtaaaaagccaaaacttttaggcaagggtatcccctattttgaagaggaagttttg
ttcgccgcaaaggaagaatttgcgttaggcgttacagacgttttggcgagaaggttcagg
gttctttttgtggatttagatctggcgaaaaagatgatagagcccgttgcgaacatactg
tcgaaacaactcaaatggaataacaaaacaaaaaaaacggaagaatccgcaaccttggaa
ctgatcgaaagtttgaaaaattcgtatcgatga

DBGET integrated database retrieval system