KEGG   Lysobacter maris: C9I47_1016Help
Entry
C9I47_1016        CDS       T05495                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lmb  Lysobacter maris
Brite
KEGG Orthology (KO) [BR:lmb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lmb01001]
    C9I47_1016
Enzymes [BR:lmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     C9I47_1016
Protein kinases [BR:lmb01001]
 Serine/threonine kinases: Other
  Bacterial family
   C9I47_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TPR_12 TPR_10 TPR_2 TPR_1 TPR_MalT TPR_19 APH TPR_11 TPR_16 TPR_6 Kinase-like TPR_14 Kdo TPR_7 Haspin_kinase RPN7 RIO1
Motif
Other DBs
NCBI-ProteinID: AWV06734
UniProt: A0A2U9T703
LinkDB All DBs
Position
complement(1274163..1277549)
Genome map
AA seq 1128 aa AA seqDB search
MSEDTPASGTETATGIYARAELVPGTVLAGRFRIESLLGVGGMGVVYRATDLALDVEVAI
KLLRPELAHRSDSFERFRSELLLARQVSDPHVVRIHDLARHQDQWLISMDYVDGAPLDRV
LDRDGPFAVEDALKIARQLAQGLAAAHAKGVVHRDLKPANVLLDAEGNAYISDFGVARSL
ATSGLTRSGSVIGTPDYLSPEQARGDPVDGRSDLYALGLILYEMLSGKPPFSSGTMAEVL
AQRMLRTPSPVTGERADVPAWIARLLDKLLRPQPNHRFQSGAEVITAIDRREVPRELHPG
KPLGWALAATLAIATGLAAWWWWRDAPPDAGLPAVATSAPLQRLLVMPLTGDGGDLPAPR
ASALDAHLRDALAAGSPMAVVDGERTTQALRQLDPTGRATADIAALGEIAAARQILQPRL
LPEPDGGWRLRARLYRGDAGSGPIALDGAVAATPLAALADWAAQATTRQALGLGEAGLAL
ALPDDGTDGGPALDAYGAGLIARRDGNLEQALQDLQQATAAAPAYTAAWLASAETAQAIG
EIDSAWDAIEQAQRSAGDAPVRLRRQLQAAHALLDGDAASAIGQWQTQLQATPDDTFAQL
QLARAQGAAGDFAAAVTTAKTLTRRDGNDPRGWYELGKFSILSGDARHAVDEYLVRALVL
YKRSRNTFGEAETVNALGIGYGRLGQTADAAEQYRKAVELRRAVGNRRGVATSLRNLAGV
SSLTGHFDQAAEHLRQARALYTELGDRDGLAAIENELGLLDEERGDYAGALAAFRRALQS
WQQAGDSHGSAQALNNIGFAHYQLGAYDDAQVYWQQATEAYRKLGSQTGLIRTAQNLGLL
DTARGRWDKARQRLRESLSNAERQQMPEEAAVSRRNLAELALWQGHLGDAIDQAEAAGAL
FRQREDQRGMLDSRLLKAQALLAAHADDEAGRILAALETGLADAPAEQQAIAALLRAGLA
RREGDAARATEALRQARQRAATSGVRQLQLQIELDAARAAAAEPGGDRQALDGATAALGH
AGLRLGWLELAMADAVAANDPQTALSAYREASGLLRNGDYRRAAALYRLAAEAHAAAGDD
RAARTAAEQARSAQARLRDSLPEALRAGFENAAGNGLAAAPQRQEDSP
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggacacccccgccagcggcaccgaaaccgcgaccggcatctatgcccgcgcc
gagctggtgccgggcaccgtgctggccggacgtttccgcatcgaatcgctgctgggcgtc
ggcggcatgggcgtggtctaccgggcaaccgacctggccctggacgtcgaagtcgcgatc
aagctgctgcgtccggagctggcgcatcgcagcgactcgttcgagcggttccgctccgag
ctgctgctcgcgcggcaggtgtcggacccgcacgtggtccgcatccacgacctggcccgc
caccaggatcagtggctgatcagcatggactacgtcgacggcgccccgctcgatcgcgtg
ctcgaccgcgacggcccgttcgcggtcgaggatgcgctgaagatcgcgcgccagctcgcg
cagggcctggccgccgcccatgccaagggcgtggtgcaccgcgacctcaagccggccaac
gtgctgctcgatgccgaaggcaatgcctacatcagcgacttcggcgtcgcccgctcgttg
gcgaccagcggcctgacccgttccggctcggtcatcggcacccccgactacctgtcgccc
gagcaggcccgcggcgatcccgtcgacggccgcagcgacctctatgcgttgggcttgatc
ctctacgagatgctcagcggcaagccgccgttctccagcggcacgatggccgaggtgctg
gcgcagcggatgctgcgcacaccgtcgccggtgaccggcgagcgcgccgacgtgccggcc
tggatcgcgcgcctgctcgacaaactgctgcgaccgcagccgaatcaccgcttccagagc
ggcgcggaggtgatcaccgcgatcgaccgccgcgaggtcccgcgcgaactgcatccgggc
aagccactgggctgggcgctggccgcgaccctggcgatcgccaccggactggccgcgtgg
tggtggtggcgcgatgccccacccgacgccgggctgcccgcggtcgcgacctccgccccg
ctgcaacggctgctggtaatgccgctgaccggtgacggtggcgatcttcccgcgccccgg
gccagcgccctcgacgcgcacctgcgcgacgcgctggccgcgggctcgccgatggcggtg
gtcgatggcgagcgcaccacgcaggcgctgcggcaactggacccgaccggccgcgccact
gcggacatcgccgctctgggcgagatcgccgccgcccgccagatcctgcagccgcggctg
ctgccggagccggatggcggctggcggctgcgcgcgcggctgtatcgcggcgatgccggg
agcggcccgatcgccctcgacggcgcggtggccgccaccccgctggcggcgctggcagac
tgggccgcgcaggcgaccacgcgccaggcgctgggtctgggcgaggccggcctggccctg
gcgctgcccgatgacggcaccgacggcgggccggcgctggacgcctacggtgccggcctg
atcgcgcgccgcgacggcaatctcgaacaggcattgcaggacctgcagcaggcgaccgcc
gcggctccggcctacaccgccgcctggctggccagcgccgaaaccgcgcaggcgatcggc
gagatcgacagcgcctgggacgcgatcgagcaggcgcagcgcagcgccggcgacgccccg
gtcaggctgagacggcagttgcaggccgcgcatgccctgctcgacggcgatgccgccagc
gccatcggccaatggcagacgcaactgcaggcgacgccggacgacaccttcgcccagctg
caactggcgcgcgcacagggcgccgccggcgacttcgccgccgcggtgaccaccgccaag
accctgacccgacgcgacggcaacgacccgcgcggctggtacgagctgggcaagttcagc
atcctcagcggcgatgcgcggcacgcggtcgacgagtacctggtgagggcactggtgctg
tacaagcgcagccgcaacaccttcggcgaggccgagaccgtcaacgcgctggggatcggc
tacgggcgcctcggccagaccgccgacgccgccgagcagtaccgcaaggcggtcgaactg
cggcgcgcggtcggcaatcgccgcggcgtcgccaccagcctgcgcaatctcgccggcgtg
tcgtcgctgaccggccatttcgaccaggccgccgagcacctgcggcaggcgcgcgccctg
tacaccgaactgggcgaccgcgacggcctggccgcgatcgagaacgagctgggactgctc
gacgaggagcgcggcgactacgccggcgcgctggccgcgttccggcgcgcgctgcagagc
tggcagcaggccggcgacagccacggcagcgcgcaggccctgaacaacatcggcttcgcc
cactaccagctcggcgcctacgacgacgcccaggtctactggcagcaggccaccgaggcc
taccgcaagctcggctcgcagaccggcctgatccgcaccgcgcagaatctcggcctgctc
gacaccgcgcgcggacgctgggacaaggcacgccagcgcctgcgggagtccctgtccaac
gccgagcggcagcagatgcccgaggaggccgcggtcagccgccgcaacctcgccgagctg
gcgctgtggcagggccatctcggcgatgcgatcgaccaggccgaggccgccggcgccctg
ttccgccaacgcgaggaccagcgcggcatgctcgacagccgcctgctcaaggcccaggcc
ctgctcgccgcccatgccgatgacgaggccggccgcatcctcgccgcgctcgagaccgga
ctggccgacgcgcccgccgaacagcaggccatcgccgccctgctgcgcgcaggactcgcg
cgccgcgaaggcgatgccgcgcgcgccaccgaagcgctgcggcaggcccggcaacgggcc
gcgacctcgggcgtgcgccagttgcagttacagatcgagctggacgccgcgcgcgccgcg
gccgccgagcccggcggcgaccggcaggccctggacggcgccaccgccgcactgggccat
gccgggctgcgtctgggctggctggaactggcgatggcggacgcggtcgccgcgaacgac
ccgcagaccgcgctgagcgcctaccgcgaggcgagcggactgctgcgcaacggcgactac
cgccgcgccgccgcgctgtaccggctggcggccgaggcccatgccgccgccggcgacgac
cgcgccgcgcggaccgccgccgagcaggcgcgatccgcgcaggcccggctgcgcgacagc
ctgcccgaggcattgcgcgcaggcttcgagaacgccgccgggaacgggcttgcggcggcg
ccgcagcgccaggaggacagcccatga

DBGET integrated database retrieval system