KEGG   Lysobacter maris: C9I47_1105Help
Entry
C9I47_1105        CDS       T05495                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
lmb  Lysobacter maris
Pathway
lmb00061  Fatty acid biosynthesis
lmb00780  Biotin metabolism
lmb01100  Metabolic pathways
lmb01212  Fatty acid metabolism
Module
lmb_M00083  Fatty acid biosynthesis, elongation
lmb_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:lmb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C9I47_1105
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C9I47_1105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lmb01004]
    C9I47_1105
Enzymes [BR:lmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     C9I47_1105
Lipid biosynthesis proteins [BR:lmb01004]
 Fatty acid synthase
  Component type
   C9I47_1105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA PS-DH MaoC_dehydratas AfsA
Motif
Other DBs
NCBI-ProteinID: AWV06822
UniProt: A0A2U9T5E2
LinkDB All DBs
Position
complement(1386774..1387229)
Genome map
AA seq 151 aa AA seqDB search
MSSTVKLPIDVTAIQAVLPHRYPFLLVDRVVELEPNKRVLAYKNVTVNEPFFNGHFPGHP
VMPGVLVVEALAQAGGLLTQLASGGSADDRLFYLVKIDNARFSRMVVPGDRLELEVVLKR
TIRNMAIYSGIARVDGEQTACADIVCAEVAA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgaccgtgaagttgccgattgacgtaaccgcgatccaggccgtgctgccgcac
cgctacccgttcctgctggtcgaccgggtggtcgaactggaaccgaacaagcgcgtactc
gcctacaagaacgtcacggtcaacgagcccttcttcaacggccacttccccggccacccg
gtgatgcccggcgtgctggtggtcgaggcgctggcccaggccggcggcctgctgacccag
ctggccagcggcggcagcgccgacgaccgcctgttctacctggtcaagatcgacaacgcc
cggttctcgcggatggtggtgcccggcgaccggctggagctggaggtcgtgctcaagcgc
accatccgcaacatggccatctacagcggcatcgcccgcgtcgacggcgaacagaccgcc
tgcgcggacatcgtgtgcgccgaggtcgcagcctga

DBGET integrated database retrieval system