KEGG   Lysobacter maris: C9I47_1495Help
Entry
C9I47_1495        CDS       T05495                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
lmb  Lysobacter maris
Pathway
lmb00380  Tryptophan metabolism
lmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    C9I47_1495
Enzymes [BR:lmb01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     C9I47_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AWV07196
UniProt: A0A2U9T3D5
LinkDB All DBs
Position
complement(1849073..1850347)
Genome map
AA seq 424 aa AA seqDB search
MTDLFDPAHAARLDASDPLPTLREQFLIPRHGDGEQAYFVGNSLGLQPRRARDHVEEVLR
TWAEVAVEGHFTGESQWMTYHGLVREQLGRLVGAKPSEVVAMNTLTTNLHLMMVSFYRPT
PERPAILIEAGAFPSDRHAMESQVRFHGFDPARDLIELEPDEPNGTLSMAAIEDAIRTHG
HRLALVLWPGIQYRTGQFFDLARIVRLTHAAGAMCGFDLAHAAGNRELALHDSGVDFAVW
CHYKYLNSGPGAIAGCFVHERHANTDRPRFAGWWGHEPSTRFLMGPDFTPTPGAEGWQLS
NPPILGMAPLRASLELFDAVGMPALRDKSLRLTGYLETLIRQRLDSVLQIVTPAEPERRG
AQLSLRVAGGRAQGRALFDYLAENGVLGDWREPDVIRISPAPLYNTHADILRFARTVEAW
RDAA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgttcgaccccgcccacgccgcccgtctcgatgcgagcgacccgctgccg
acgctgcgcgagcagttcctgatcccgcgccatggcgacggcgagcaggcctacttcgtc
ggcaattcgctcgggctgcagccgcggcgcgcgcgcgaccacgtcgaggaggtgctgcgc
acctgggccgaggtcgcggtcgagggccacttcaccggcgagtcgcagtggatgacctac
cacgggctggtgcgcgagcagctcggccgcctggtcggcgccaagccatcggaagtggtc
gcgatgaacaccctgaccaccaacctgcacctgatgatggtcagcttctaccggccgacc
ccggaacggccggcgatcctgatcgaggccggcgcgtttccgtccgaccgccacgcgatg
gagtcgcaggtgcgcttccacggcttcgacccggcccgcgacctgatcgagctggaaccc
gacgagcccaacggcaccctctcgatggcggcgatcgaggacgcgatccgcacccacggc
caccgcctcgccctggtgctgtggccggggatccagtaccgcaccggccagttcttcgac
ctcgcccggatcgtgcggctgacccacgccgccggcgcgatgtgcggcttcgacctcgcc
cacgcggccggcaaccgcgagctggcgctgcacgacagcggcgtcgacttcgcggtctgg
tgccactacaagtacctcaacagcggccccggcgcgatcgccggctgcttcgtccatgag
cgtcatgccaataccgatcgcccgcgcttcgccggctggtggggacacgagccctcgacc
cggttcctgatggggccggacttcacgcccaccccgggggccgagggctggcagttgagc
aacccgccgatcctcggcatggcaccgttgcgcgcttcgctggagctgttcgacgcggtc
ggcatgccggccctgcgggacaagtcgctgcgcctgaccggctatctggaaaccctgatc
aggcagcgcctggacagcgtgctgcagatcgtcaccccggccgagcccgagcgtcgcggc
gcgcagttgtcgctgcgcgtcgccggtggccgcgcccagggacgtgccctgttcgattac
ctggccgagaacggcgtgctcggcgactggcgcgaaccggacgtgatccggatctcgccg
gcaccgctgtacaacacccatgccgacatcctgcgcttcgcgcgaaccgtggaggcctgg
cgcgatgccgcttga

DBGET integrated database retrieval system