KEGG   Lysobacter maris: C9I47_2124Help
Entry
C9I47_2124        CDS       T05495                                 

Definition
(GenBank) peptidase M20
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lmb  Lysobacter maris
Brite
KEGG Orthology (KO) [BR:lmb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lmb01002]
    C9I47_2124
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmb04147]
    C9I47_2124
   04090 CD molecules [BR:lmb04090]
    C9I47_2124
Enzymes [BR:lmb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     C9I47_2124
Peptidases [BR:lmb01002]
 Metallo Peptidases
  Family M2
   C9I47_2124
Exosome [BR:lmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C9I47_2124
CD molecules [BR:lmb04090]
 Proteins
  C9I47_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 YkuD
Motif
Other DBs
NCBI-ProteinID: AWV07807
UniProt: A0A2U9T991
LinkDB All DBs
Position
2649016..2651031
Genome map
AA seq 671 aa AA seqDB search
MKPVRALLALSVIAVLGLSACSRDGSDDSAGTSVAPEGETADQFVARVNDEMRAMTPEIT
SAQWLASTYINSDSQLIASKANERMLAQLNSWIEQSRKFEGQEMSPQTARAIQLLKLGTS
MPAPKDPAKLEELASLATKMEGMYGAGSYCTGEGDDKQCRQLGELEDVLRHDRDYADQLD
AWQGWHTISVPMRKDYTRFVELVNEGAQEMGYADAGEMWRSGYDMTPVEIAAETDRLWGQ
VKPLYEQLHCYTRTRLEAKYGADKGEVAGGMLPAHLMGNMWQQDWGNLWDILAPYKNAGS
LDVTGALESQWQNNFSAQMAKHRGERDASDLVEMERAADLATARQMTERAEDFYTSLGMP
KLPATYWDRTQFIKPRDRDVVCHASAWPMDMADDVRTKMCIKPNEEDFTTIYHELGHVYY
YMLYKDQPPIFQTGAHDGFHEAIGDTIVLAMTPEYLNSIDLVGEQQQSEQALINAQMRMA
LAKVSFLPFGLMIDRWRWGVFDGTIKPEEYNKAWWDLKAKYQGVAPVTPRGEEFFDPGAK
YHVPGNTPYTRYFLSHVLQFQFYKALCDASGHEGPLYQCSFYGNKEAGEKFQAMLSKGAS
QPWQQTLKELTGGESMDASAVLEYFAPLQDWLKQQNEGKTCGWQASAAPAPAAPAADGGE
AATEQDQPAKG
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgtccgcgcgctactcgcgctcagcgtcatcgccgtgctcggcctgtccgcc
tgctcccgcgacggcagcgacgactccgccggcacctcggtcgcgcccgaaggcgagacc
gccgaccagttcgtcgcccgcgtcaacgacgaaatgcgcgcgatgaccccggagatcacc
tccgcgcagtggctcgcctccacctatatcaacagcgacagccagttgatcgcctccaag
gccaacgagcgcatgctggcccagctcaacagctggatcgagcagtccaggaagttcgag
ggccaggaaatgtcgccgcagaccgcgcgcgcgatccagctgctcaagctcggcacctcg
atgccggcgcccaaggacccggccaagctggaggagctggcttcgctggcgaccaagatg
gaaggcatgtacggcgccggcagctactgcaccggcgaaggcgacgacaagcagtgccgt
cagctcggcgagctggaggacgtgctgcgccacgaccgcgactacgccgaccagctcgat
gcctggcagggctggcacacgatctcggtgccgatgcgcaaggactacacccgcttcgtc
gaactggtcaacgaaggcgcccaggagatgggctatgccgacgccggcgagatgtggcgc
tcgggctacgacatgaccccggtcgagatcgccgccgagaccgaccgcctgtggggccag
gtcaagccgctgtacgaacagctgcactgctatacccgcacccgcctggaagccaagtac
ggcgccgacaagggcgaggtcgccggcggcatgctgccggcccacctgatgggcaacatg
tggcagcaggactggggcaacctctgggacatcctcgccccgtacaagaacgccggcagc
ctcgacgtcaccggcgcgctggagagccagtggcagaacaacttctccgcccagatggcc
aagcaccgcggcgagcgcgatgcctccgatctggtcgagatggagcgcgccgccgacctc
gccaccgcccgccagatgaccgagcgcgccgaggatttctacacctcgctgggcatgccc
aagctgccggccacctattgggaccggacccagttcatcaagccgcgcgaccgcgacgtg
gtctgccacgccagcgcctggccgatggacatggccgacgacgtgcgcaccaagatgtgc
atcaagccgaacgaggaagacttcaccacgatctaccacgagctcggccacgtctattac
tacatgctgtacaaggaccagccgccgatcttccagaccggcgcccacgacggcttccac
gaggcgatcggcgacaccatcgtgctggcgatgacgccggagtacctgaactcgatcgac
ctggtcggcgagcagcagcagagcgagcaggcgctgatcaacgcgcagatgcggatggcg
ctggccaaggtctcgttcctgccgttcggcctgatgatcgaccgctggcgctggggcgtg
ttcgacggcacgatcaagcccgaggaatacaacaaggcgtggtgggacctgaaggccaag
taccagggcgtcgccccggtcaccccgcgtggcgaggagttcttcgatccgggcgccaag
taccacgtgccgggcaacaccccgtacacccgctacttcctctcgcacgtgctgcagttc
cagttctacaaggcgctgtgcgacgcttccggccacgagggcccgctctaccagtgcagc
ttctacggcaacaaggaagccggcgagaagttccaggcgatgctgagcaagggcgccagc
cagccgtggcagcagaccctcaaggaactgaccggcggcgagagcatggacgcctcggcg
gtgctggaatacttcgcgccgctgcaggactggctgaagcagcagaacgagggcaagacc
tgcggctggcaggccagtgccgccccggcaccggccgctcccgccgccgatggcggcgag
gccgcgacggagcaggatcagccggccaagggctga

DBGET integrated database retrieval system