KEGG   Lysobacter maris: C9I47_2279Help
Entry
C9I47_2279        CDS       T05495                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
lmb  Lysobacter maris
Pathway
lmb00260  Glycine, serine and threonine metabolism
lmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C9I47_2279
Enzymes [BR:lmb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     C9I47_2279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AWV07962
UniProt: A0A2U9T8R1
LinkDB All DBs
Position
2823805..2824830
Genome map
AA seq 341 aa AA seqDB search
MMKALVKREAGKGIWMEQVPVPSPGPNEVLVKLEKTAICGTDLHIYLWDEWSQRTIEPGL
VIGHEFVGRVVEIGPGVTGYRPGQRVSAEGHIVCGHCRNCRAGRQHLCPNTIGIGVNRNG
AFAEYIVMPASNLWPIPDQIPGELAAFFDPYGNAAHCALEFDVVGEDVLITGAGPIGIIA
AGICKYIGARNVVVTDVNDYRLKLAADMGATRVVNVANTSLKEVMADLHMEGFDVGLEMS
GNPRAFNDMLDCMYHGGKIAMLGIMPKGAGADWDKIIFKGLTIHGIYGRKMYETWYKMTQ
LVLSGFPLGKVLTHQLPIDDFQEGFDLMESGKAGKVVLSWV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggccctggtcaaacgcgaagcaggcaagggcatctggatggaacaggtgccg
gtgccgtcaccgggcccgaacgaggtcctggtcaagctggaaaagaccgcgatctgcggc
accgacctgcacatctacctgtgggacgagtggagccagcgcacgatcgagccgggactg
gtgatcggccacgagttcgtcggccgcgtggtcgagatcggcccaggcgtcaccggctac
cgcccgggccagcgcgtctccgccgagggtcacatcgtctgcggccactgccgcaactgc
cgcgccggccgccaacacctgtgtccgaacacgatcggcatcggcgtcaatcgcaacggc
gcgttcgccgagtacatcgtgatgccggccagcaacctgtggccgatccccgatcagatc
cccggcgagctggccgcgttcttcgacccctacggcaatgccgcgcactgtgcgctggaa
ttcgacgtggtcggcgaggacgtgctgatcaccggcgcgggtccgatcggcatcatcgcc
gccggcatctgcaagtacatcggcgcgcgcaacgtggtcgtcaccgacgtcaacgactac
cgcctcaagctcgccgccgacatgggcgcgacccgcgtggtcaacgtcgccaacacctcg
ctgaaggaagtgatggccgacctgcacatggagggcttcgacgtcggcctggaaatgagc
ggcaatccgcgcgcgttcaacgacatgctcgactgcatgtaccacggcggcaagatcgcg
atgctcggcatcatgcccaagggcgccggcgccgactgggacaagatcatcttcaagggc
ctgaccatccacggcatctacggccgcaagatgtacgagacctggtacaagatgacccaa
ctggtgctgtcgggcttcccgctcggcaaggtgctgacccatcaactgccgatcgacgac
ttccaggaaggcttcgacctgatggaatcgggcaaggccggcaaggtcgtgctgagctgg
gtctga

DBGET integrated database retrieval system