KEGG   Listeria monocytogenes CLIP 80459 (serotype 4b): Lm4b_01302Help
Entry
Lm4b_01302        CDS       T00898                                 

Gene name
glpD
Definition
(GenBank) Putative glycerol 3 phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lmc  Listeria monocytogenes CLIP 80459 (serotype 4b)
Pathway
lmc00564  Glycerophospholipid metabolism
lmc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Lm4b_01302 (glpD)
Enzymes [BR:lmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Lm4b_01302 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_oxidored FAD_binding_3 Pyr_redox 3HCDH_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CAS05066
LinkDB All DBs
Position
1305156..1306832
Genome map
AA seq 558 aa AA seqDB search
MVQLFSAFDRETIERNLQEEKFDLVIVGGGITGAGIALDATSRGMSVALVEMGDFASGTS
SRSTKLVHGGLRYLQQFEIKEVADLGKERAIVYENGPHVTTPEWMMLPFHKGGNMGKTTA
SFGIRLYDYLAGVKKNERRKILSAKETLAKNPFVKKDGLKGSGYYVEYRTDDARLTIEVM
KKAVELGANAINYTKAEHFLYDDNKQVVGVTVTDRLSGKAYDIKGHRVINAAGPWVDKVR
KLDYATNNKHLRLTKGIHLVIDKQKFPMEQAVYFDTPDGRMVFAIPRDKKVYVGTTDTVY
DEAVINPKALESDHNYVIKAINYMFPDVHITEKDIESSWAGVRPLIYEEGKDPSEISRKD
EVWFSESGLITMAGGKLTGYRKMAEKLLDDVSKTLAKETGKKYKTVQTKHLPISGGDIGG
SEQLEAFLSKKAKEGNNRFGWTLEEGREMAKRFGSNIDQLFTYAQEHKEQNETTLPNSLY
AELRYSIQHEAVTTPIDFLLRRTGYLLFDMPYLLEWKDAVVDEMAKQFHWSDDVKQTYIE
ELNIQINDAREPADWHDR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtacaattattttcagcgtttgacagagaaacaatcgaaagaaatcttcaagaggaa
aaatttgatttagtcatcgtcggcggcgggattacaggggcaggaatcgctttagatgcc
acttcacggggtatgagtgtcgcacttgttgaaatgggtgatttcgcgagcggaacatcg
agccgttcaacaaaattagtccacggtggattaagatatttacaacaatttgaaattaaa
gaagtagcagatttaggaaaagaacgtgcgatagtctacgaaaatggaccacacgtaacg
actcctgaatggatgatgctcccattccataaaggcggcaatatgggtaaaactaccgct
tcatttggtattcgtttatatgactatttagcaggggtaaagaaaaatgaacgacgtaaa
attttaagcgcaaaagaaacattagccaaaaatccattcgtgaaaaaagacggtttaaaa
ggttctggttactacgtggaataccgcacggatgatgcgcgtttaacaatagaagttatg
aaaaaagcagtagaactcggagcgaatgctattaactatacaaaagcagagcatttctta
tatgatgacaataaacaagtagttggtgtaaccgtaacagatcgtttgtcgggcaaagca
tacgatattaaaggacatcgtgttattaatgctgctggtccttgggtagataaagtaaga
aaattagattatgcaacaaacaacaaacatttacgcttaacaaaaggaattcatttggtt
attgataaacaaaaattcccgatggaacaagcagtatactttgatacacctgatggccgg
atggtctttgctattccgcgcgataaaaaagtgtatgttggaacgacggatacagtgtac
gacgaagcagtaattaatccaaaagcacttgaatctgatcataattatgtgattaaggcg
attaattatatgttccctgatgtgcatattaccgaaaaagatattgaatcaagttgggct
ggggttcgtccacttatctatgaagaaggaaaagatccatctgaaatttcacgtaaagat
gaagtttggttttctgaaagtggcttaatcacgatggcaggtggtaaactcactggttac
agaaaaatggccgaaaaattattagatgacgtttcaaaaacattagcgaaagaaactggt
aaaaagtacaaaacagttcaaacaaaacatttaccaatttctggtggtgacattggtggc
tcagaacaattagaagctttcctatctaaaaaagcgaaagaaggtaataatcgtttcggc
tggactttagaagaaggtcgtgagatggctaaacgtttcggtagtaatatcgatcaatta
tttacttatgcacaggaacataaagaacaaaacgaaaccactttaccaaacagtttgtat
gctgaactacgctactcgattcaacacgaagcagtgacaacgccaatcgatttcttatta
cgtcgcactggctacttgcttttcgatatgccatacttacttgaatggaaagacgctgtt
gtggatgaaatggctaaacaattccactggagcgacgatgtaaaacaaacctatatcgag
gaattaaatattcaaattaatgatgctagagaaccagctgattggcacgatagataa

DBGET integrated database retrieval system