KEGG   Leisingera methylohalidivorans: METH_02170Help
Entry
METH_02170        CDS       T02961                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lmd  Leisingera methylohalidivorans
Pathway
lmd00061  Fatty acid biosynthesis
lmd00780  Biotin metabolism
lmd01100  Metabolic pathways
lmd01130  Biosynthesis of antibiotics
lmd01212  Fatty acid metabolism
Module
lmd_M00083  Fatty acid biosynthesis, elongation
lmd_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:lmd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    METH_02170
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    METH_02170
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    METH_02170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lmd01004]
    METH_02170
Enzymes [BR:lmd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     METH_02170
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     METH_02170
Lipid biosynthesis proteins [BR:lmd01004]
 Fatty acid synthase
  Component type
   METH_02170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AHC99678
UniProt: V9VPP4
LinkDB All DBs
Position
complement(415992..416783)
Genome map
AA seq 263 aa AA seqDB search
MAGLLTGKRGLIMGVANDRSIAWGIAKAMAEAGAELAFTYQGEAFGKRLEPLAQSVGSDF
MVDVDVTDDASLDAAFEQLGSRWPSLDFVVHAIAYSDKSELTGRFLDTSRANFKNSLDIS
AYSFIEVARRAHPLMKDNGGTLLTLTYQGSNQVVPNYNVMGVAKAALESATRYLANDLGP
EGIRVNAISPGPMKTLAGAAIGGARKTFKHTAQNAPMRENATLEAVGGTAVYLASDAGAC
TTGEIIRVDGGFHVLGMPQQDHL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgggactgctgaccggcaagcgcggcctgattatgggcgttgccaatgaccgctcc
atcgcctggggcattgccaaagccatggcagaagccggggctgaactcgccttcacctat
cagggcgaagcctttggcaagcggctggagccgctggcgcagagtgtcggctcggatttc
atggtcgatgtggatgtgaccgacgacgcttcgctggatgccgcgttcgaacagcttggc
agccgctggccgtcactcgatttcgtggtgcatgcgattgcctattcggacaaatccgag
ctgaccgggcgcttcctggacaccagccgggcgaacttcaagaactcgctggatatctca
gcctattccttcatcgaagtggcgcgccgcgcccacccgctgatgaaagacaacggcggc
accctgctgactctgacctatcaggggtcgaaccaggttgtgccgaactataatgtcatg
ggcgtggccaaggcagcgctggagtcggcgacccgttacctggccaatgacctggggccg
gaaggcatccgggtgaacgcgatctcgcccggcccgatgaagacgcttgccggtgccgcc
atcggcggcgcacgcaagaccttcaagcacacggcccagaatgcgccaatgcgcgagaac
gccacgctggaagcagtgggcggcaccgcggtgtatctggcgtctgatgcaggcgcttgc
acgaccggagaaatcatccgggttgatggcggtttccatgtgctgggaatgccgcagcag
gatcatctgtaa

DBGET integrated database retrieval system