KEGG   Leisingera methylohalidivorans: METH_05065Help
Entry
METH_05065        CDS       T02961                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lmd  Leisingera methylohalidivorans
Pathway
lmd00240  Pyrimidine metabolism
lmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    METH_05065
Enzymes [BR:lmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     METH_05065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AHD00174
UniProt: V9VR36
LinkDB All DBs
Position
complement(981954..982556)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQASHNYRENRMDTYLLTARLDDRAGEGRIASRIGIGEAAD
MFAAGDDLYARIEQRLRRGPVAAIFVDEAQFLSPDQVWQLARVVDDLRVPVLAYGLRVDF
QGNLFPGSATLLALADEMREVRTICHCGKKATMVVRQDDQGRVLTEGDQVQIGGNETYVS
LCRRHWREAAGDLRSSGTAE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttcaactactccaccatgaacgcgggcaagtcgacggtgctgttg
caggcgtcgcataactaccgcgaaaaccgcatggacacctacctgctgaccgcccggctg
gatgaccgcgccggcgagggcagaatcgcctcgcggatcggcatcggcgaagcggcggac
atgtttgccgcgggcgacgatctttatgcccgcatcgaacaacggctgcgccgcggcccg
gttgcggcgatctttgtggacgaggcccagttcctgtcgcccgaccaggtctggcagctg
gcccgcgtcgtcgatgacctgcgggtgccggtgctggcctacgggctgcgggtggatttt
cagggcaatctgttccccggctccgccaccctgctggcgctggcggatgaaatgcgcgag
gtgcgcaccatctgccactgcggcaaaaaggccaccatggtggtccgccaggacgatcag
ggccgggtgctgaccgagggcgaccaggtgcagatcggcggcaatgagacctatgtctcg
ctctgccgccgccactggcgtgaagcggcaggcgatctgcgcagcagcggaacggcagag
taa

DBGET integrated database retrieval system