KEGG   Leisingera methylohalidivorans: METH_09060Help
Entry
METH_09060        CDS       T02961                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
lmd  Leisingera methylohalidivorans
Pathway
lmd00030  Pentose phosphate pathway
lmd01100  Metabolic pathways
lmd01110  Biosynthesis of secondary metabolites
lmd01120  Microbial metabolism in diverse environments
lmd01130  Biosynthesis of antibiotics
lmd01200  Carbon metabolism
lmd01230  Biosynthesis of amino acids
Module
lmd_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
lmd_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:lmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    METH_09060
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    METH_09060
Enzymes [BR:lmd01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     METH_09060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AHD00808
UniProt: V9VS34
LinkDB All DBs
Position
1745510..1747531
Genome map
AA seq 673 aa AA seqDB search
MDLTALRTANPDHWNKAAAIRALALDAVAAANSGHTGMPIGMADVATVLFEKHLKFDASN
PKWPDRDRFILSAGHGSMLIYALLYLSGDKQVTLDQIKNFRQTGAITAGHPENFLIDAVE
VTTGPLGQGLSNAVGFAMAEEMQRAHYGKKVVDHHTYVIAGDGCLMEGISQEAIGLAGRH
QLGKLIVFWDNNNITIDGTVELSDRTNQVQRFKASGWQVLEIDGHDPKAIDEAITAAKKS
KKPSMIACKTHIALGHAAQDTSKGHGALTDQDQLQAAKDAYGWTSGPFEVPADIKSQWEE
IGARGKTEREAWEARFAELSSQKQDRFNRAYSLDAPKKLSATIKALKKQASETQPKVATR
KSSEMALEVINPIMPETVGGSADLTGSNNTKTGDLGMFDTDNRKGRYVYWGIREHGMAAA
MNGMVLHGGVRAYGGTFFCFTDYARPAMRLAALSKIPTVFVMTHDSIGVGEDGPTHQPVE
HLAICRATPNTYVFRPADTVETAEAWEIALTSKETPSVLALTRQNLPTVRTEHKLSNMVE
KGAYVLAEAENKRQVILIATGSEVSVAMDAKAKLEAEGIGTRVVSMPCMELFAEQDEAYR
RKVLPAGPIRVGIEAAVRDGGWDRWLLGERGQEKKAGFVGMDRFGASAPAGELFERFGIT
AEGTVAKVKELLG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgacagccctgcgcaccgccaatcccgaccattggaacaaggccgccgccatt
cgcgcgctggcactggacgccgtcgccgccgccaattccggccacaccggcatgccgatc
ggcatggccgacgtggcgaccgtgctgtttgaaaagcacctcaaattcgatgcctccaac
ccgaagtggccggaccgcgaccgcttcatcctgtcggcgggccacggctcgatgctgatt
tatgcgctgctctatctgtccggcgacaaacaggtgacgcttgatcagatcaagaacttc
cgccagaccggcgcgatcaccgcgggccatccggaaaacttcctgatcgacgcggtcgag
gtcaccaccgggccgctcggccagggcctctccaacgctgtcggctttgccatggccgag
gaaatgcagcgcgcccattacggcaagaaggtcgtcgatcaccacacctatgtgatcgca
ggcgacggctgcctgatggaaggcatcagccaggaggccatcggcctggccggccgccac
cagctgggcaagctgatcgtgttctgggacaataacaacatcaccatcgacggcacggtt
gagctcagcgaccgcaccaaccaggtgcagcgcttcaaggcctccggctggcaggtgctg
gaaatcgacggccacgaccccaaggccatcgacgaggcgatcaccgccgccaagaagtcc
aagaaaccctcgatgattgcctgcaagacccatattgccctgggccatgccgcgcaggac
acctccaaaggccacggcgcgctgaccgaccaggaccagctgcaggcggccaaggatgcc
tatggctggaccagcggccccttcgaagtgccggcggatatcaaatcccagtgggaagaa
atcggcgcccgcggcaagaccgagcgcgaagcctgggaagcccgctttgccgagctgtcc
tcgcaaaaacaggaccgtttcaaccgcgcctacagcctggacgcccccaagaagctgtcc
gccaccatcaaggcgctgaaaaagcaggcgtccgagacccagcccaaggttgccacccgc
aagtcttcggaaatggcgctggaagtgatcaacccgatcatgccggaaaccgtgggcggc
tctgctgacctgaccggatccaacaacaccaagaccggcgatctgggcatgttcgacacc
gacaaccgcaaagggcgttacgtctattggggtatccgcgagcatggcatggccgcggcg
atgaacggcatggtgctgcacggcggcgtgcgcgcttacggcggcaccttcttctgcttc
accgactatgcccgcccggcaatgcgcctggccgccctgtcgaagatcccgaccgtgttc
gtgatgacccacgattcaatcggtgtcggcgaagacggcccgacccaccagccggtcgaa
cacctggcgatctgccgcgccaccccgaacacctatgtgttccgccccgccgacaccgtg
gaaaccgccgaggcctgggaaattgccctcacctccaaggagaccccgtcggtgctggcg
ctgacccgtcagaacctgccgaccgtccggaccgagcacaagctcagcaacatggtcgaa
aaaggcgcctatgtgctggccgaggccgagaacaagcgccaggtgatcctgatcgccacc
ggttctgaagtctctgtcgcaatggacgccaaggccaagctggaagccgagggcatcggc
acccgtgtggtctccatgccctgcatggagctgtttgccgagcaggacgaagcctaccgc
cgcaaggtgctgcccgcaggcccgatccgcgtcggcatcgaggccgctgtccgtgacggc
ggctgggaccgctggctgctgggcgagcgcggccaggagaaaaaggccggttttgtcggc
atggaccgcttcggcgcctcagccccggcaggcgagctgttcgagcgcttcggcatcacc
gccgagggtaccgtcgccaaggtgaaagagctgctgggctaa

DBGET integrated database retrieval system