KEGG   Leisingera methylohalidivorans: METH_10295Help
Entry
METH_10295        CDS       T02961                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
lmd  Leisingera methylohalidivorans
Pathway
lmd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmd01100  Metabolic pathways
lmd01110  Biosynthesis of secondary metabolites
lmd01130  Biosynthesis of antibiotics
lmd01230  Biosynthesis of amino acids
Module
lmd_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lmd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    METH_10295
Enzymes [BR:lmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     METH_10295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 TsaE Cytidylate_kin AAA Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AHD01021
UniProt: V9VQK2
LinkDB All DBs
Position
complement(1978642..1979232)
Genome map
AA seq 196 aa AA seqDB search
MSEKEQDRGQKAAGPVPGKLKKTIVMVGMMGAGKTAVGRALAARLDVPFLDSDHEIEAAA
NMTIPEIFARDGEPFFRLKERQVIARLLEEERGVLSTGGGAFLAEENRNVITAKGVSVWL
QADLDVLWNRVRHRDTRPLLRTADPRATLSGLFRDRVPLYAKADLTVVSDGQAAIETMVD
RVLEALQARPDVLEWT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaaagagcaagacagaggccagaaggcagcaggcccggtgccggggaaactg
aagaagaccatcgtgatggtgggtatgatgggggccggcaagaccgccgtggggcgcgcg
ctggcggcccggctggatgtgcctttcctggacagcgaccacgagatcgaggccgcagcc
aatatgacgatccccgagatttttgcccgcgatggcgagccgttcttccgcctaaaggaa
cggcaggtgatcgcccggctgctggaagaggaacgcggtgtgctgtcgacgggcggcggc
gcctttctggcggaagaaaaccgcaatgtgattaccgccaaaggggtctcggtctggctg
caggccgatctggatgttctgtggaaccgggtgcgccaccgcgacacccggccgctgctg
cgcacggctgatccgcgtgcgaccctcagcggcctgttccgcgaccgggtgccgctttat
gcaaaggcagacctgaccgtcgtttcggacggccaggcggcaattgaaaccatggttgac
cgggtgctggaagccttgcaggcgcgccccgatgtattggagtggacatga

DBGET integrated database retrieval system