KEGG   Leisingera methylohalidivorans: METH_12500Help
Entry
METH_12500        CDS       T02961                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lmd  Leisingera methylohalidivorans
Pathway
lmd00473  D-Alanine metabolism
lmd00550  Peptidoglycan biosynthesis
lmd01100  Metabolic pathways
lmd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lmd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    METH_12500
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    METH_12500
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    METH_12500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lmd01011]
    METH_12500
Enzymes [BR:lmd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     METH_12500
Peptidoglycan biosynthesis and degradation proteins [BR:lmd01011]
 Precursor biosynthesis
  Amino acid ligase
   METH_12500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AHD01391
UniProt: V9VRM3
LinkDB All DBs
Position
complement(2404261..2405181)
Genome map
AA seq 306 aa AA seqDB search
MSKSSRALPKVAVLMGGPSAEREVSLSSGRECAAALRGEGFEVVEVDAGRDLYARLADIK
PDVAFNALHGRWGEDGCVQGVLEWLGIPYTHSGVLASALAMDKQRSKEVYRAAGLPVVES
GLFAKDEVGAGHVMAPPYVVKPNNEGSSVGIYIVQEAANGPPQLSEEMPSEVMVETYAPG
RELTTTVVGDKALTVTDILTDGWYDYDAKYKPGGSRHVLPADLPREIHDLCLDYALKAHE
VLGCRGVSRTDFRWDEARGAGGLILLETNTQPGMTPTSLVPEQAAFCGMDFGELCAWMVE
DASCNR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaagtcgagcagggcactcccgaaagtcgcggtgctgatgggcggaccgtcagcc
gaacgcgaagtatcgctgtccagcggccgtgaatgcgcggccgctttgcgcggtgagggg
tttgaggttgtcgaggtggatgcaggccgggacctgtacgcgcgcctggcggatatcaag
ccggatgtggcgtttaacgcgctgcacgggcgctggggcgaggacggctgtgtgcagggt
gtgctggaatggctgggcatcccctatacccattccggggtgctggcctcggcgctggcg
atggacaagcagcgctccaaggaagtgtaccgcgccgccgggctgccggttgtcgaaagc
ggcttgtttgccaaggatgaggtcggcgcaggccatgtgatggcgccgccttatgtggtg
aagcctaacaatgaaggctccagcgtcggcatttatattgtgcaggaggctgccaacggc
ccgccgcagttgtcggaagaaatgccgtccgaggtgatggtcgaaacctatgcgccgggg
cgcgagctgaccaccaccgtggtcggggacaaggcgctgacggtgaccgatatcctgacc
gatggctggtatgattatgacgccaaatacaagcccggcggctcgcgccatgtgctgccc
gcggacctgccgcgggaaattcatgacctgtgcctggactatgcgctgaaggcgcatgag
gtgctgggctgccgcggtgtcagccgcaccgatttccgctgggacgaggcgcgcggcgcg
ggcgggctgatcctgctggagaccaatacccagccggggatgactccgacctcgctggtg
ccggagcaggcggccttctgcggcatggattttggcgagttgtgcgcctggatggtggag
gatgcctcatgcaaccgctga

DBGET integrated database retrieval system