KEGG   Leisingera methylohalidivorans: METH_17555Help
Entry
METH_17555        CDS       T02961                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
lmd  Leisingera methylohalidivorans
Brite
KEGG Orthology (KO) [BR:lmd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    METH_17555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AHD02204
UniProt: V9VWU9
LinkDB All DBs
Position
3431139..3431888
Genome map
AA seq 249 aa AA seqDB search
MTVFGDFSFLVFAGLIGGLVNVVAGGSKLFVFPMLMAAGLPPLVANATATAGLWPAQLPG
VWVFRRSLAADRHRHVLDAIIAAAGAVTGAVLLYALGEAAFLSIVPGFLVLAAVAILFGD
QLSKLGQRLAGRNRAAARVMFLFTGVYAGYFGAGYGFLIVAAVFLAGEGSIHVATARKNF
ISLGANTAAVVPFSLTGLVAWDAAITVLISGLAGGAIGGRAMTYLPQRLLKRIIAACGIF
LAASFLIRS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcttcggtgacttttcatttcttgtttttgcggggctgattggcgggcttgtc
aatgtcgtggccggtggatccaagctgtttgtgttcccgatgctgatggccgccggtctg
ccgcctcttgtcgctaatgcgaccgcgacagcagggctgtggcctgcccagctccccggt
gtctgggtgttccgcagatcgcttgccgccgaccggcacaggcatgttctggacgccatc
atcgccgccgcaggcgctgtcaccggtgcggtgctgctctatgctctgggtgaggccgct
ttcctgtcaattgttccgggcttccttgttctagctgccgtcgcgatcctctttggcgac
cagttgtcaaagctggggcagcgcttggcaggcaggaacagagctgcggcgcgcgtgatg
tttctgttcacaggcgtctatgccggatacttcggcgcgggatatgggttcctgatcgtg
gctgcagtgtttctggcgggcgagggttccatccacgtcgcgacggcgcgcaagaatttc
atatctctgggagcgaatacagccgcggtcgttccgttttccctgactggtcttgttgcc
tgggatgcagcgattacggtgctgatcagcggccttgccggtggcgcgattggcggtaga
gcaatgacatacttgcctcaaaggcttttgaagcggatcatcgcggcgtgcggaatcttt
ctggctgcgagtttcttaatccggtcatag

DBGET integrated database retrieval system