KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1580Help
Entry
LEUM_1580         CDS       T00411                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00970  Aminoacyl-tRNA biosynthesis
lme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lme00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LEUM_1580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lme03029]
    LEUM_1580
Enzymes [BR:lme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LEUM_1580
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LEUM_1580
Mitochondrial biogenesis [BR:lme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LEUM_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABJ62672
UniProt: Q03VV0
LinkDB All DBs
Position
complement(1584439..1585905)
Genome map
AA seq 488 aa AA seqDB search
MTINYFEHDLTSLHNQLVNKEVSAVDLTRASLDNISKTDDKLNAFISTNPDEAIAQAQKI
DEKSDFSNVLTGLPLGLKDNMATKGIQTTGASHILEGFKPIYNATVVEKLQNLGAVSVGK
TNMDEFAMGGSTETSYYKQTSNAWDHSKVPGGSSGGSAAAVAAGQVPFALGSDTGGSIRQ
PAAFNGIVGLKPTYGRVSRWGLFAMASSLDQIGPFTRTVKDNATVLNAIAGFDEKDSTSS
QREVPDFTAKLSGDVKGLKIAVPKEYFGEGIDPKVAKQVKAAIAQLEALGATVDEVSLPH
TKYGVAAYYIIMSSEASSNLQRYDGVRYGFRADDVKNLEDLYVKTRSEGFGDEVKRRIML
GTFSLSAGAYDAFFKKAAKIRTLLIEDFNKVFENYDVIVGPTAPTAAYGLGEEVDDPTAM
YLADVLTIPVNLAGLPGLSVNAGFVDGLPVGLQIIGKPFDEQTVYQTGYAYEQASRLFEQ
HPDVAKEY
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaattattttgagcatgatttaacttctttgcacaatcagttggtaaacaaa
gaagtaagtgcggtagatttgacacgtgcatcgcttgataacatttctaaaactgatgat
aaattaaatgcatttattagcacaaacccagacgaagctatagcacaagctcaaaaaatt
gatgaaaaatctgatttttcgaatgtcttgacgggtctccctttgggattgaaagataat
atggcaaccaagggcattcaaacaacgggtgcttcgcatattttggaaggttttaagcca
atctataatgcgacagtggtggaaaaattgcaaaacctaggggcggtttctgttggaaag
actaacatggatgaatttgccatgggtggttcaacagaaacctcatactataaacaaaca
tcaaatgcgtgggatcatagtaaggtgccaggtggatcatcaggtggatcagctgcagca
gttgccgctggacaagtgccatttgcattagggtctgataccggtggttcaattcgccag
ccagctgcctttaatggaattgttggtttaaagcctacgtatggtcgtgtttcacgttgg
ggcttgtttgccatggcttcttcacttgatcaaatcgggcctttcacaagaactgtgaag
gataacgcaacagtactaaatgctattgctggtttcgacgagaaagactcaacttcatcg
cagcgtgaagtgcctgatttcactgcaaagttaagcggtgatgttaagggcttaaagatc
gctgtgccaaaagaatactttggtgaaggtattgatccaaaagttgccaagcaagtcaag
gctgctattgcacaattagaagcattgggagcaactgttgacgaagtaagtcttccacac
actaaatacggtgtggctgcatactatattatcatgtcatcagaagcatcatctaactta
caacgttatgatggtgtgagatatggtttccgtgccgatgacgttaaaaacttggaagat
ttatatgtcaaaacacgttcagaaggttttggtgacgaagtcaagcgtcgtatcatgtta
ggaacgttctcattgtcagctggagcgtatgatgctttctttaagaaggccgctaaaatt
cgtacattgttgattgaggactttaataaggtttttgaaaactatgatgtaattgttgga
cctactgcgccaacagctgcatatggtcttggtgaagaggttgatgaccctacagcaatg
tacctggcagatgttttgactatcccagtaaacttagctggtctacctggtttgtcagtc
aacgctggatttgttgatggattgcctgtgggcttgcaaattattggtaagccatttgac
gaacagactgtttatcaaacaggatatgcttacgaacaagccagccgtttgtttgaacaa
catcctgacgttgcgaaagaatattaa

DBGET integrated database retrieval system