KEGG   Listeria monocytogenes F2365 (serotype 4b): LMOf2365_2303Help
Entry
LMOf2365_2303     CDS       T00174                                 

Definition
(GenBank) transcription regulator
  KO
K02250  competence protein ComK
Organism
lmf  Listeria monocytogenes F2365 (serotype 4b)
Pathway
lmf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMOf2365_2303
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lmf03000]
    LMOf2365_2303
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lmf02044]
    LMOf2365_2303
Transcription factors [BR:lmf03000]
 Prokaryotic Type
  Other transcription factors
   Others
    LMOf2365_2303
Secretion system [BR:lmf02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   LMOf2365_2303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK SpoIISB_antitox
Motif
Other DBs
NCBI-ProteinID: AAT05069
LinkDB All DBs
Position
2355550..2356158
Genome map
AA seq 202 aa AA seqDB search
MKKEQISTQFYEVNPHTMIIFPKKSGSIVYSEIYEVDSHYTSKFTPFELIKTSCNFFGSS
YEGRKEGTKHLIGVTHKPPIIIDPVTSTYVFPTVAPSSTECIWIFPQHIKDYHAIGFNHT
LITFSNMETFEIDMSLASFNNQIARTSMLHMKFSQKMRIMESNFPSMNRFFPPTTLAAEP
RRYYSTMLPNNEDPNEPQDPEQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaacaaatcagtactcagttttatgaagtaaacccgcacacaatgattatt
tttccaaaaaaatctggaagtatagtctattcagaaatttatgaagttgattcccattat
acttctaaatttaccccgtttgaactaattaaaaccagctgtaactttttcggttcaagc
tatgagggacgcaaagagggaactaaacacttaattggtgttacccataagccacccatt
atcattgacccagtcacttctacttatgtatttccaactgtagcacctagttcaacagaa
tgtatttggattttcccacaacatattaaagattatcatgcaattggatttaaccacact
ttaataacattttctaatatggaaacctttgagattgatatgtctttagcatcttttaat
aatcagattgctagaacctccatgttacatatgaaattttctcaaaaaatgcgtataatg
gagagtaattttccttcaatgaataggtttttcccaccaaccactcttgctgctgaacct
agacgttattacagcaccatgcttccaaataacgaagatcctaatgagcctcaagatcct
gagcagtaa

DBGET integrated database retrieval system