KEGG   Listeria monocytogenes F2365 (serotype 4b): LMOf2365_2334Help
Entry
LMOf2365_2334     CDS       T00174                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmf  Listeria monocytogenes F2365 (serotype 4b)
Pathway
lmf00250  Alanine, aspartate and glutamate metabolism
lmf00410  beta-Alanine metabolism
lmf00430  Taurine and hypotaurine metabolism
lmf00650  Butanoate metabolism
lmf01100  Metabolic pathways
lmf01110  Biosynthesis of secondary metabolites
lmf01120  Microbial metabolism in diverse environments
lmf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LMOf2365_2334 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOf2365_2334 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMOf2365_2334 (gadB)
   00430 Taurine and hypotaurine metabolism
    LMOf2365_2334 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMOf2365_2334 (gadB)
Enzymes [BR:lmf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMOf2365_2334 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: AAT05100
LinkDB All DBs
Position
2386555..2387949
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKNQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAQKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKDHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIYNDGSHLPIVCYKLKDDANVKWTLYDLADRLQMRGWQVPAYPLPKNLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatataccctcggaaaagaaccactagaacctcggattgcc
tatcgtttagtgaaagacgaacttttagatgaaggttctgcccgtcaaaacttagctact
ttttgccaaacatatatggaagacgaagcaaccaaattaatgtccgaaacactagaaaaa
aatgcaatcgataaatctgagtacccaagaacagctgaactagaaaatcgttgcgtcaat
attatcgctgacttatggcatgcacctaagaaccaaaaattcatgggaacttccacaatc
ggctctagtgaagcgtgtatgctgggcggaatggcaatgaaatttgcttggagaaaacgt
gcggaaaaacttggcttagatatttatgcgcaaaaaccaaacctcgttatctcctctggc
taccaagtgtgctgggaaaaattctgtgtctactgggatatcgatatgcgcgttgttcca
atggataaagatcacatgcaactgaataccgaccaagtccttgattacgtcgacgaatat
acaatcggcgttgtcggcatcctcggcatcacttacacaggccgctacgatgacatctac
gcacttaacgaaaaattagaagaatacaatagcaaaacagattataaagtctacattcac
gtcgatgcagcaagtggcggattcttcacaccatttgtcgaacccgatattatctgggac
ttccgcttgaaaaacgttatctccattaatacttctggtcacaaatacggcctcgtttat
cctggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaacttattttt
aaagtcagctaccttggcggagaaatgccaaccatgcaaatcaatttctcccgcagtgcg
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcatcaaaaaacaagcgatgtagcacaataccttgcccatgcagtcgaacaaaccggc
tactttgacatttataacgacggctcccatttaccaatcgtctgctataaattaaaagac
gacgctaacgtaaaatggacattatatgatttagcggaccgcctccaaatgcgcggctgg
caagttcccgcatacccactaccaaaaaacttagaaaacatcatcatccaacgttacgtc
tgccgcgctgacctcggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgctcacatcctcttccatgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system