KEGG   Listeria monocytogenes FSL R2-561: LMKG_00690Help
Entry
LMKG_00690        CDS       T01985                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase, family 3
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:lmg00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LMKG_00690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lmg01011]
    LMKG_00690
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lmg03036]
    LMKG_00690
Enzymes [BR:lmg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     LMKG_00690
Peptidoglycan biosynthesis and degradation proteins [BR:lmg01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   LMKG_00690
Chromosome and associated proteins [BR:lmg03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    LMKG_00690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 SH3_3 SH3_4 SH3_16 SH3_1 GW Ribosomal_L12
Motif
Other DBs
NCBI-ProteinID: AEO25868
LinkDB All DBs
Position
1574743..1576026
Genome map
AA seq 427 aa AA seqDB search
MKNKFIFITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPGLAYDVTSQARKNEV
LRVVGEENQWYKVQLDNGNSGWVASWLVENTDVSAASNSVAIVSSDGGLNVREKPSTSSK
SLGLLNNGDQVTVTSQQNGWAQIQYNGTSAWVSSDYLTIRESVTKVDESELQTVTIRDDS
TNIRNKPSRDGAVIEKANSGQGFAIQGVQGDWYKIRTTSGEEGYVANWVVDVSDKGQTSS
PRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEMTLKTAKQLKQKLEARGAKVILTR
NSDKYVSLKGRTNIAAENNADVFISIHFDSLEDASKGVSGQTTYYYDNSDKSLAESINTT
LGKDLPTTNRGARVGDYYVVRENSQPAVLLELGYLSSAKDENNINSASYRSQIAESVTDG
LSNYFSN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataaattcatttttatcaccgttgtctccattttattgattgcagcaggtatt
tttacaaccatagcaatggcgaacgcgaattccgttgtcgtcaaagcagaagtcttaaat
gtccgtagcggtcctggtttagcatatgatgtaacgagccaagccagaaaaaatgaagta
ctccgggtagtcggtgaagaaaatcaatggtacaaagttcagttagataacggaaatagc
ggttgggttgcaagctggttagtagaaaacactgatgtcagcgcagcaagtaacagtgtc
gctatcgtttcttctgacggcggtttgaatgtacgtgaaaaaccaagtacctcaagtaaa
tcacttggattgctaaataatggtgatcaagtaacagttactagccaacaaaacggctgg
gcgcaaatccaatataacggaacaagcgcatgggttagctccgattacttaactattcgt
gaatctgttacaaaagtagatgaaagtgagctacaaacagtaaccattcgcgatgactcc
actaatattagaaataagccaagtcgtgatggtgccgtcatcgaaaaagcaaattctggc
caagggttcgctattcagggagtacagggtgactggtataaaatacgaacgacaagcggc
gaagaaggttatgtagctaactgggtagtcgatgtttccgacaaaggtcaaacatccagc
cctcgaagcaaaacaaccaaattatccgaagcaaccatcgttattgaccccggacatggt
ggcaatgatccaggtgctaaaggggcaaatggcacaattgaaaaagaaatgactttaaag
acagccaaacaattaaaacaaaaattagaagctagaggcgctaaagtaatcttaacgaga
aacagtgataaatatgtctctctaaaaggaagaacaaatatagctgccgaaaataatgca
gatgtgtttattagtattcattttgatagcttagaagacgcaagcaaaggtgtaagcggt
caaacaacttattattatgataatagtgataaatcgcttgctgaaagtattaatactacg
ctcgggaaagatctccctactactaatcgtggtgcaagagtcggcgattattatgtagtc
agagaaaattcacaaccagcagtcctcttagaacttggttatctaagttccgcaaaagat
gaaaataatattaattcagcatcttacagaagccaaattgctgaatcagtaacagacggc
ctatctaattacttctctaattaa

DBGET integrated database retrieval system