KEGG   Listeria monocytogenes FSL R2-561: LMKG_01955Help
Entry
LMKG_01955        CDS       T01985                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg00061  Fatty acid biosynthesis
lmg00780  Biotin metabolism
lmg01100  Metabolic pathways
lmg01130  Biosynthesis of antibiotics
lmg01212  Fatty acid metabolism
Module
lmg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lmg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LMKG_01955
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LMKG_01955
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LMKG_01955
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lmg01004]
    LMKG_01955
Enzymes [BR:lmg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LMKG_01955
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LMKG_01955
Lipid biosynthesis proteins [BR:lmg01004]
 Fatty acid synthase
  Component type
   LMKG_01955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AEO25269
LinkDB All DBs
Position
1000216..1001004
Genome map
AA seq 262 aa AA seqDB search
MNLSLEGKTYVVMGVANKRSIAWAIARSLNEAGAKLVFTYADDRAKKSITELVPSLSEVN
QNPLILACDVTSEEAITETFETIKDKAGKLSGLAHCIAFANKDFLTGDYLEVDRKSFLQA
HEISAYSFTAVARALKHLEMLTEDASLLTLTYLGGERVVENYNIMGVAKASLDASVRYLA
MDLGAIGVRVNAISAGPIRTVSARGVSGFSDSISLVEERAPLKRATQAEEVGDTAYYLFS
NLSRGVTGEVIHVDSGYHIIGF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatcattagagggaaaaacttatgttgtaatgggagtagctaataagcgtagt
attgcttgggcaattgcgcgttcactaaatgaagctggagcaaaactggtatttacatat
gcggacgatcgtgcgaaaaaaagcattacagagctagtaccttcattaagcgaagtaaat
caaaatccacttatcttagcttgtgatgtaacaagtgaagaagctattacagaaactttt
gaaacaattaaagataaagctggcaaacttagcggcctagcacactgcattgcttttgca
aacaaagactttttaactggggactatttagaagtagatcgtaaaagcttcttacaagca
catgaaattagtgcctattcatttacagctgtagctcgtgcactaaaacacttggaaatg
ttaacagaagatgcaagtttactaacgctaacttaccttggtggggaacgtgtagtagaa
aactataatattatgggtgtagcaaaagcttcccttgatgcaagcgttcgataccttgca
atggatctaggcgcaattggggttcgtgtgaatgctatttcagcaggaccaatcagaaca
gtatctgctcgtggcgttagcggtttctctgattctatttcactagtagaagaaagagct
ccactaaaacgtgcgacacaagcggaagaagttggcgatacagcgtattacttattcagt
aatttatctcgaggcgttactggtgaagtaattcatgtagatagcggttatcatattatt
ggattttaa

DBGET integrated database retrieval system