KEGG   Listeria monocytogenes FSL R2-561: LMKG_02542Help
Entry
LMKG_02542        CDS       T01985                                 

Definition
(GenBank) phosphate ABC transporter
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lmg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LMKG_02542
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmg02000]
    LMKG_02542
Enzymes [BR:lmg01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     LMKG_02542
Transporters [BR:lmg02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    LMKG_02542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_15 AAA_23 AAA_29 AAA_30 RsgA_GTPase AAA AAA_18 TniB Rad17 AAA_16 AAA_33 AAA_28 AAA_25 NB-ARC RNA_helicase AAA_7 AAA_27 AAA_14
Motif
Other DBs
NCBI-ProteinID: AEO26838
LinkDB All DBs
Position
complement(2589617..2590432)
Genome map
AA seq 271 aa AA seqDB search
MLTKKPEINTILQATPDPHSLPAAMATEDLHVYYGDNHAIKGVDLTFPENKVTALIGPSG
CGKSTYLRALNRMNDEIDGCRMEGQILYDGININRKEVDLYNVRKEIGMVFQKPNPFTKS
IYENVAFGLKRHGMKNKKEIMERVEKSLRRAALWDEVKDDLGKSALSLSGGQQQRLCIAR
AVAMQPKVLLLDEPASALDPISTSKIEDLINELKNKYTIIIVTHNMQQAARVSDYTSFFY
LGEVVEFSGTSELFTNPQEKQTEDYISGNFG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgaagaaacctgaaattaatacaattttacaagcaacaccagatcctcattca
cttcctgctgcaatggcgacagaggatttgcacgtatactatggggacaatcatgcaatt
aaaggcgtcgatttaacgttccccgaaaataaagtaacagctttaatcggaccatctggt
tgcgggaaatcaacttatctaagagcattaaaccgaatgaatgatgaaattgacggttgt
cgtatggaaggacaaattttatacgacggcattaatatcaaccgcaaagaagttgattta
tacaatgttcgtaaagaaataggcatggtgttccaaaaacctaacccattcacgaaatct
atctatgaaaatgttgcttttggacttaaacgccatggcatgaagaacaaaaaagaaatc
atggaacgagttgaaaaaagtttgcgtcgtgcggctctttgggacgaagtaaaagatgat
ttaggaaaaagtgcgctatccctttccggtgggcaacaacaacgactttgtatcgctaga
gctgtcgcaatgcaacctaaagtattgctactcgatgaaccagcatctgcgctagatcca
atttccacaagtaaaattgaagatttaattaatgagttaaaaaataaatataccatcatt
atcgtaacgcacaatatgcaacaagcagctcgggtttcagactatacttctttcttttat
ctaggagaagtcgtggaattctcaggaacatccgaactatttacgaatccacaagaaaaa
caaaccgaagactatatttctggtaactttggctag

DBGET integrated database retrieval system