KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_0168Help
Entry
LMHCC_0168        CDS       T00801                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00250  Alanine, aspartate and glutamate metabolism
lmh00410  beta-Alanine metabolism
lmh00430  Taurine and hypotaurine metabolism
lmh00650  Butanoate metabolism
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01120  Microbial metabolism in diverse environments
lmh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LMHCC_0168
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMHCC_0168
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMHCC_0168
   00430 Taurine and hypotaurine metabolism
    LMHCC_0168
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMHCC_0168
Enzymes [BR:lmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMHCC_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACK38530
LinkDB All DBs
Position
168413..169816
Genome map
AA seq 467 aa AA seqDB search
MLYSENDKRKHESYRIPLFGSEEESTSIPKYVLKKEPMEPRIAYQLVKDQLMDEGNARQN
LATFCQTYMEKEAEILMAETLEKNAIDKSEYPQTAELENRCVNILADLWNAPKEMAYLGT
STVGSSEACMLGGLAMKFRWRNHAEKRGLDIQAKRPNLIISSGYQVCWEKFCVYWDVDMR
VVPMDKEHLSIDVDKVFDLVDDYTIGIVGILGITYTGKFDDIALLNEKVEAYNEANEHQL
VIHIDGASGAMFTPFVNPELPWDFRLKNVVSINTSGHKYGLVYPGVGWILWKDKEYLPKE
LIFEVSYLGGSMPTMAINFSRSASQIIGQYYNFLRYGFEGYREIHEKTKKTALYLAKTVE
KSGYFEIINDGANLPIVCYKMKEGLDVEWTLYDLADQLLMKGWQVPAYPLPADLSDTIIQ
RFVCRADLGYNVAEEFAADFADALHNLEHARVLYHDKERNDSYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctttatagtgaaaacgacaagcgaaaacatgaaagttatcgaatcccgctctttgga
tctgaagaagaaagcacgagtatcccgaaatatgtattaaaaaaggaaccgatggaacca
cgtatagcctatcaattagtgaaagatcagttgatggatgaaggcaatgcgcggcaaaac
ttggcaactttttgtcagacatacatggaaaaagaggcagaaatactgatggcagaaacg
ctcgagaaaaatgcaattgataaatccgaatatccgcaaacagctgaactagaaaatcgc
tgcgtcaatattttagccgatttgtggaatgcgccaaaggagatggcttacttggggact
tcgactgttggttcttcggaagcgtgtatgcttggcggtttggcaatgaaatttcgctgg
cgtaaccatgcggaaaagcgtggtctagatattcaggcaaaacgaccgaacttaattatt
tcatcaggctaccaagtatgttgggaaaaattttgtgtgtattgggatgtcgatatgcgt
gttgtaccaatggataaagagcatctcagtatcgatgtagataaagtgtttgatttggtc
gatgattacacaattgggattgtcgggattttaggcattacttatacaggtaaatttgat
gatatcgccttattaaatgaaaaagtagaagcatacaatgaagcaaatgagcatcaatta
gttattcatattgacggcgcaagtggcgcgatgtttacaccatttgtaaatccagaatta
ccttgggatttccgccttaaaaatgttgtttctataaatacttccggtcataaatacgga
ttggtttatcctggtgttggttggattttatggaaagacaaagaatatttaccaaaagaa
cttatttttgaagtcagctacttaggtggttcgatgccgacgatggcgattaacttctct
cgtagcgctagccaaattattgggcaatattataatttcttgcgttatggatttgaaggt
taccgagaaatccatgaaaaaacaaagaaaacagccctttacttggcaaaaactgtagaa
aaaagtggctattttgaaattattaatgatggcgctaatttgccgattgtctgttacaaa
atgaaagaaggactggatgtcgagtggacgctgtatgatttagctgatcagcttttaatg
aaggggtggcaagttccagcctatccacttccggcagatttaagtgatacgattattcaa
cggtttgtttgccgggcggacttaggctataacgtggccgaggagtttgcggctgacttt
gcagacgcgcttcataatttagagcatgcaagagtactttatcatgacaaagaacgaaac
gattcatacggatttacgcattaa

DBGET integrated database retrieval system