KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_0809Help
Entry
LMHCC_0809        CDS       T00801                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADTsubunit A)
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00970  Aminoacyl-tRNA biosynthesis
lmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LMHCC_0809
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lmh03029]
    LMHCC_0809
Enzymes [BR:lmh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LMHCC_0809
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LMHCC_0809
Mitochondrial biogenesis [BR:lmh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LMHCC_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACK39161
UniProt: B8DFG8
LinkDB All DBs
Position
818982..820433
Genome map
AA seq 483 aa AA seqDB search
MGLFDFSVKELHDKLVKKEISPFDLVSESFNRIESVEDKVGSFITLNKEAAFGVAEELGD
AGIDPNNMLAGLPIGIKDNIVTKSLRTTAASKILENFDPIYDATVVSKLKNAQTINIGKL
NMDEFAMGSSTETSYFHKTHNPWDLSRVPGGSSGGSASAVAAGEVLFSLGSDTGGSIRQP
AAFCGVVGMKPTYGRVSRFGLIAFASSLDQIGPITKNVEDNAYLLEAISGLDANDSTSIN
QPVERFSDSLTGDIKGLRIGVPKEYLGEGVDPGVKQAVLDALKTLEKLGATWDEVSLPHS
EYGVASYYILASSEASSNLSRFDGVRYGYRSPNATTLEELYTKTRSEGFGDEVKRRIMLG
TYALSSGYYDAYYKKAQQARTLIKQDFVNVFENYDVIIGPSSPTTAFKIDGMINDPITMY
SNDILTVPINLAGVPAISVPCGFSDGLPVGLQIIGNYFEESLLYKVAHAFEQETTFHKEK
PNL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
ttgggtttatttgatttttcagtaaaagaactacatgataaattagtaaaaaaagagatt
tcaccatttgatttagtatcagaatctttcaaccgaattgaatctgtagaggacaaagtt
ggttcttttattactttaaataaagaagcagcatttggtgtcgcagaagaacttggagat
gctggtattgatcctaacaatatgcttgcaggtcttccaatcgggattaaagataatatt
gttacaaaaagcttgcgcacaacagcagcaagtaaaattttagaaaacttcgatccaatt
tacgatgcaactgttgtgtctaaattaaaaaacgcgcaaacaattaatatcggaaaatta
aacatggatgaatttgcgatgggatcttcgacagaaacatcgtatttccacaaaacacat
aacccgtgggatttatcaagagttcctggtggctcttcaggtggtagtgcatctgcagtt
gcagctggcgaagttttattctcgcttggtagtgacactggcggctcgattcgccaacca
gcagctttttgtggggtagtcggaatgaaacctacatatggccgtgtatctcgttttggt
ttaattgcctttgcgtcttccttagaccaaatcggtccaattactaaaaatgtagaagat
aatgcctatttactagaagcaatttctggtttagatgcaaatgattcaacttccatcaac
caaccagttgaacgcttctcagatagcttaacaggagacattaaaggcttacgcatcggt
gttccaaaagaatatcttggcgaaggcgttgatcctggcgtaaaacaagcagtattagat
gcgcttaaaacacttgaaaaacttggcgcgacttgggatgaagtttctttacctcattct
gaatacggtgtagcaagttattacattttagcatctagtgaagcttcttctaatctatct
cgttttgacggcgttcgttacggataccgttctccaaacgcaactactttagaagaactt
tatacaaaaactcgttctgaaggctttggcgatgaagtaaaacgtcgtattatgcttgga
acatatgcgttaagttctggttattacgatgcttactacaaaaaagcacaacaagcgcgt
acgttaattaagcaagactttgttaatgtatttgaaaactatgatgttattatcggacct
agttccccgacaacagcatttaaaattgacggaatgattaacgatccaattacaatgtat
tccaacgatattttaactgttccgattaacttagcaggtgtgccagctatttctgttcct
tgtggattctcagacggcttaccggtaggattacaaattatcggtaactacttcgaagaa
tcattactttacaaagtagcgcacgcatttgaacaagaaacaacattccataaagaaaaa
ccaaacttatag

DBGET integrated database retrieval system