KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_0810Help
Entry
LMHCC_0810        CDS       T00801                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT subunit B)
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00970  Aminoacyl-tRNA biosynthesis
lmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LMHCC_0810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lmh03029]
    LMHCC_0810
Enzymes [BR:lmh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LMHCC_0810
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LMHCC_0810
Mitochondrial biogenesis [BR:lmh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LMHCC_0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey MOZART1
Motif
Other DBs
NCBI-ProteinID: ACK39162
UniProt: B8DFG9
LinkDB All DBs
Position
820445..821875
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNTNTTVVDLGMPGVLPVLNKRAVEFGM
KAAMAINCEIAEHTKFDRKNYFYPDNPKAYQISQFDKPIGEHGWIEIEVGGKKKKIGITR
LHLEEDAGKNTHTSHGYSLVDINRQGTPLIEIVSEPDIRSAEEAYAYLEKLKSIIQYTGV
SDVKMEEGSMRCDANISIRPIGQEEFGVKTELKNLNSFNNVRKGIEYEEKRQAEVLKSGG
IIEQETRRFEEATGKTSLMRIKEGSDDYRYFPEPDLVDLFIDDAWKERIRAEIPELPDKR
QIRYINDLGLPAYDAMVLTLTKEMSDFFEATLAAGADAKQASNWLMGEVSAYLNAEQKEL
HETGLTPENLAGMIKLIEAGTISSKIAKKVFRELAQNGGDAEQLVKDKGLVQISDEGALR
TIISEILDNNEQSIVDFKNGKDRAVGFLVGQVMKATKGQANPPMVNKLLLEEMNKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacagttattggacttgaggttcacgtagagttaaaaaccaattcaaaa
atattttcttctgcgccagctcattttggagcagaaccaaatacaaatacaaccgtggta
gacttaggaatgccaggtgttttaccagttttaaataaacgtgcagtggaatttggtatg
aaagcagccatggcaattaactgtgagattgctgaacatacaaaattcgaccgcaaaaac
tatttttacccagataatcccaaagcataccaaatttcccaattcgataaaccaattggc
gaacatggctggattgaaatcgaagttggtggtaaaaagaaaaaaatcggcattactcgt
cttcatttagaagaagatgctgggaaaaatacccatacttctcatggttattcgttagtg
gatattaaccgtcaaggaacaccacttatcgaaatcgtttcagaaccagacattcgttct
gcagaagaagcatatgcgtacttagaaaaattaaaatctatcattcaatacactggcgta
tccgatgtgaaaatggaagaaggttcgatgcgctgtgatgccaatatctctatccgtcca
atcggccaagaagaatttggcgtaaaaacagaacttaaaaacctaaactctttcaacaac
gtacgtaaaggtatcgaatatgaagaaaaacgccaagctgaagtacttaagtctggcggg
attatcgaacaagaaactcgtcgttttgaagaagcaacaggaaaaacctctttgatgcga
attaaagaaggatccgacgattatcgttatttcccagaaccagatttagtagatttattt
attgatgatgcttggaaagaacgtattcgtgcagaaattcctgaacttccagacaaacgc
caaattcgttacattaacgatcttggtttgccagcatatgatgcaatggttctcacgctt
acaaaagaaatgtctgacttttttgaagcaacgcttgcagctggagcagatgcaaaacaa
gcttcaaactggctaatgggcgaagtttctgcctacttaaacgcagaacaaaaagaactt
catgaaacaggactaactcccgaaaaccttgctgggatgattaaattaatcgaagccggt
actatttcctctaaaattgccaaaaaagttttccgcgaattagcgcaaaatggtggcgat
gcagagcaattagtaaaagacaaaggacttgtccaaatttctgatgaaggagctttacgc
actatcattagtgaaattctagataacaatgagcaatccattgtcgacttcaaaaatggt
aaggatcgtgcggttggattcttagttggtcaagtaatgaaagcaaccaaaggacaagca
aacccaccaatggttaataaattattactagaagaaatgaacaaacgttaa

DBGET integrated database retrieval system