KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_1279Help
Entry
LMHCC_1279        CDS       T00801                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00564  Glycerophospholipid metabolism
lmh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LMHCC_1279
Enzymes [BR:lmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LMHCC_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_oxidored FAD_binding_3 Pyr_redox 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ACK39625
LinkDB All DBs
Position
complement(1317869..1319545)
Genome map
AA seq 558 aa AA seqDB search
MVQLFSAFDRETIERNLQEEKFDLVIIGGGITGAGIALDATSRGMSVALVEMGDFASGTS
SRSTKLVHGGLRYLQQFEIKEVADLGKERAIVYENGPHVTTPEWMMLPFHKGGNMGKTTA
SFGIRLYDYLAGVKKNERRKILSAKETLAKNPFVKKDGLKGSGYYVEYRTDDARLTIEVM
KKAVELGANAINYTKAEHFLYDDNKQVVGVTVTDRLSGKAYDIKGHRVINAAGPWVDKVR
KLDYATNNKHLRLTKGIHLVIDKQKFPMEQAVYFDTPDGRMVFAIPRDKKVYVGTTDTVY
DEAVINPKALESDHNYVIKAINYMFPDVHITEKDIESSWAGVRPLIYEEGKDPSEISRKD
EVWFSESGLITMAGGKLTGYRKMAEKLLDDVSKSLAKETGKKYKPVQTKHLPISGGDIGG
SEQLEAFLSKKAKEGNNRFGWTLEEGREMAKRFGSNIDQLFTYAQEHKEQNETTLPNSLY
AELRYSIQHEAVTTPIDFLLRRTGYLLFDMPYLLEWKDAVVDEMAKQFHWSDDVKQTYIE
ELNIQINDAREPADWHDR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtacaattattttcagcatttgacagagaaacaatcgaacgaaatctacaagaggaa
aaatttgatttagtcatcatcggtggcgggattacaggagcgggaatcgctttagatgca
acttcacgaggaatgagcgttgcgcttgttgaaatgggtgattttgcaagtggtacatca
agccgttcgacaaaactagtccacggaggactgcgctatttacaacaattcgaaatcaag
gaagtagcagatttaggaaaagaacgtgcaattgtctacgaaaatggacctcacgtaaca
actcctgaatggatgatgctcccattccataaaggcggcaacatgggcaaaacaactgct
tcattcggaattcgtttatatgattatttagcaggtgtaaagaaaaatgaacgccgcaaa
attttaagcgcaaaagaaactttagctaaaaatcctttcgtgaaaaaagatggattaaaa
ggctctggttactacgtagagtaccgtacagatgatgcgcgtttaacaatagaagtcatg
aagaaagcggtagaactcggtgcaaatgccattaactatacaaaagcagagcatttctta
tacgatgacaataaacaagtagtcggcgtaactgtaacagaccgtttgtcaggtaaagca
tatgacattaaaggccaccgcgttattaatgcagccggcccgtgggtggataaagtaaga
aaattagattatgcaacaaacaacaaacatttacgcttaacaaaaggaattcatttagtt
attgataaacaaaaattcccgatggaacaagcagtatactttgatacgcctgatggccgc
atggtttttgctattccgcgtgataaaaaagtatacgtagggacaacggatacagtctat
gacgaagcagtaatcaatccaaaagcactcgaatccgatcataactatgtgattaaagcg
attaattatatgttccctgatgtgcatattaccgaaaaagacattgaatcaagttgggct
ggagttcgtccacttatttatgaagaagggaaagatccatccgaaatttctcgtaaagat
gaagtttggttttctgaaagtggcttaattacaatggctggtggtaaactcactggatac
agaaaaatggccgaaaaattattagatgatgtttctaaatcactagcaaaagaaaccggt
aaaaaatacaaaccagttcaaacaaaacatttgcctatttctggtggggatattggtggc
tcagaacaattagaagcattcctatcgaagaaagcgaaagaaggaaataatcgctttggt
tggacattagaagagggtcgcgagatggcaaaacgttttggtagcaatatcgatcaattg
tttacgtatgcgcaagaacacaaagagcaaaacgaaaccactttgccaaacagtttatat
gcggaactacgttattcgattcaacacgaagcagtaacaacgccgattgatttcttatta
cgtcgtacaggctacttacttttcgatatgccatacttgcttgaatggaaagatgcggtt
gtagatgaaatggctaaacaattccactggagtgacgatgtaaaacaaacttatatagaa
gaattaaatatccaaattaatgatgctagagagccagctgattggcacgatagataa

DBGET integrated database retrieval system