KEGG   Leishmania mexicana: LMXM_12_0630Help
Entry
LMXM_12_0630      CDS       T02288                                 

Definition
(RefSeq) putative alanine aminotransferase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
lmi  Leishmania mexicana
Pathway
lmi00220  Arginine biosynthesis
lmi00250  Alanine, aspartate and glutamate metabolism
lmi01100  Metabolic pathways
lmi01200  Carbon metabolism
lmi01210  2-Oxocarboxylic acid metabolism
lmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMXM_12_0630
   00220 Arginine biosynthesis
    LMXM_12_0630
Enzymes [BR:lmi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LMXM_12_0630
Amino acid related enzymes [BR:lmi01007]
 Aminotransferase (transaminase)
  Class I
   LMXM_12_0630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Ribonuc_red_lgN
Motif
Other DBs
NCBI-GeneID: 13454910
NCBI-ProteinID: XP_003873167
UniProt: E9ANZ0
LinkDB All DBs
Position
12
AA seq 497 aa AA seqDB search
MLRNAARSFSPKRCYVSPQVIEAEYAVRGLIPTRADEIKADLLTGRGSYSFESLVYCNIG
NPQSVGQMPLTFCRQVMALVDAPFLLEDAEIVGRLPEDAVARARRYLAEIGTGTGAYTES
FGYRFARAAVAAHINERDHGVSPAATVNDICLTDGASMGAKLFLQLLVGGAGDAVMIPVP
QYPLYSAQIALLGGVKVPYYLHESEGWVMKLPDLVAAYERCVAENGATPRLFVCINPGNP
TGNVLERCVMEDVVRFCHERGMLLLADEVYQENVYDTRRRFLSFREVALGMPEPYCSETV
LVSLHSTSKGLIGECGRRGGYFCMTNLPDALRQQVVKLCSINLCANVNGQLMTALMCSPP
REDEASYVVHRRECDEIFTGMKERAELLARELGTVRGVSCQPVEGAMYAFPRIVLPERYA
QRNEELNAAEGRRLELDARWALELLESSGIVVVPGSGFGQEPGTLHFRITILPPLAQIDR
MVHAIRQFQDQIYEQYA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaatgctgctcgcagcttttcgccaaagcgatgctacgtaagcccgcaggtc
atcgaggcggaatacgccgtgcgggggctgatcccaacccgcgcggatgagatcaaggcg
gacctgctcactggccgcggctcctactcgttcgaaagcctcgtgtactgcaacatcggc
aacccacagtcggtggggcagatgcccctaacgttctgccgacaggtgatggcacttgtg
gatgcgccgttcctgctggaagatgcggagatcgttgggcggctgccggaggacgcggtt
gcgcgtgcgcgcaggtaccttgcggagatcgggacgggtaccggcgcgtacacagagtcg
ttcggctaccggtttgcgcgcgctgccgttgctgcgcacattaacgagcgcgaccacggc
gtgagccccgctgcgacggtgaacgatatctgtctgacagacggcgctagcatgggtgcg
aagcttttcctgcagctgctcgtgggcggcgcgggcgatgctgtgatgatcccggttccg
cagtatccgctatactctgcgcagatcgcgctacttggcggggtgaaggtgccctactac
ctgcatgagtcggaggggtgggtgatgaagttgccggatcttgttgccgcgtacgagcgg
tgcgtggccgagaacggggcgacgccgcgcttgttcgtgtgcatcaatcccgggaacccg
acggggaacgtgctggagcgctgcgtgatggaggacgtcgtgcggttctgccacgagcgc
ggcatgctgctgcttgcggacgaggtgtaccaggagaacgtgtacgacacgcggcgccgg
tttttgagcttccgcgaggttgcgcttgggatgcctgagccgtactgctcggagacggtg
cttgtgtccttgcactcgacatcaaaaggactgattggtgaatgcgggcggcgcggcggg
tatttctgtatgacgaatctgcctgatgcgctgcgccagcaggttgtgaagctgtgctcg
attaacctctgtgcgaatgtgaacggacagttgatgactgcgctgatgtgctcgccgccg
cgcgaggacgaggcgagctacgtagtgcaccggcgcgagtgcgacgagatctttacgggc
atgaaggagcgcgctgagctgctcgcgcgcgagcttgggactgtgcgtggggtctcgtgc
caaccggtggagggcgcgatgtacgcgttcccgagaattgtgttgcctgagcggtacgcc
cagcggaacgaggagctgaacgcagcggagggtcggcggctcgagctggacgcgcggtgg
gcgctggagctgctggagtcaagcggtatcgttgttgtgcccgggtctgggtttgggcag
gagcccgggacgctgcacttccggataacgattctcccacctcttgcacagattgatcgg
atggtgcatgcgatccgccagttccaggaccagatctacgagcagtacgcgtag

DBGET integrated database retrieval system