KEGG   Leishmania mexicana: LMXM_18_0480Help
Entry
LMXM_18_0480      CDS       T02288                                 

Definition
(RefSeq) putative uracil-DNA-glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
lmi  Leishmania mexicana
Pathway
lmi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:lmi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LMXM_18_0480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lmi03400]
    LMXM_18_0480
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     LMXM_18_0480
DNA repair and recombination proteins [BR:lmi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     LMXM_18_0480
 Prokaryotic type
     LMXM_18_0480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 13447623
NCBI-ProteinID: XP_003874062
UniProt: E9ARI5
LinkDB All DBs
Position
18
AA seq 373 aa AA seqDB search
MQKTLLDFVRKGTSSNGPAAANAVVAADRGRQRQRQWPSASNGEGTTPRTDSPPKKHAKT
LREDSRNRSNSREPERDSLKGASRDDAVDLDASVSVALLESTLPHSEQGGTVDKAKHVSS
GTTVPAAAAAITSRWLAGLITNLEWRDFLAPITADSWRGGAFARIERFLDGEKEKGRAIL
PPATDIFNAFNSCPFRGLKVVLLGQDPYHDLHQAHGLCFSVLPEVPLPPSLRNIYKELTT
DIAGFQAPRHGYLQSWSEQGMLMLNATLTVEAHKANSHSKTSGWTAFTDAVIQHLSQHHP
NRLVFLLWGGYAQQKKKLIDASRHIVLESVHPSPLSASRGWFGCHCFSACNEALQSMGHL
PMHWQLPLNASLR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagacgctcttagattttgtgcggaagggcaccagcagcaacggcccagctgcc
gccaacgcggtcgtcgccgcggacagagggcggcagcggcagcggcagtggccctcggca
tcgaacggcgagggcaccacgcctcggacggactcaccgcctaagaaacacgccaagact
ctgcgcgaggacagtcgcaaccgtagtaactccagggagcccgaaagggatagtctgaag
ggtgcctctagagatgacgcggttgacctcgacgcgagtgtgtcagtcgcactcctggag
tcgacactcccccatagcgaacagggcggtaccgttgacaaggcgaagcacgtctccagc
ggcactactgtgcctgctgctgccgctgccatcaccagccgttggcttgccggcctaatc
acgaacctcgagtggagagacttcctggctcccattacggctgattcgtggcgaggtggc
gccttcgcccgcattgagcgctttctcgatggggaaaaggaaaagggcagggccatactg
ccgcctgccacggacatcttcaacgcgttcaacagctgcccatttcgtggcttgaaggtg
gtcctgctcggccaggacccgtaccacgatcttcaccaagcgcatggactctgcttctcc
gtcttgcccgaagtaccgcttccgccgagcctgcgtaacatatacaaggagctcacgacg
gacatcgcgggcttccaggcaccaaggcacggctacctgcagagctggtcggagcagggg
atgctgatgctgaacgcgactctgaccgtcgaggcgcacaaggccaactcgcacagcaaa
accagtggctggaccgccttcacggacgccgtcatccagcacctttcccagcaccacccc
aaccggctcgtgtttctgctctggggtggctacgcgcagcagaagaagaagctcatagac
gcaagccggcacattgtcctggagagcgtgcacccatcaccgttgagcgccagccgcggc
tggttcgggtgccactgcttctctgcgtgcaacgaggcgctgcagagcatgggccacctt
cccatgcattggcagctgccattgaatgcttcgctgcgctga

DBGET integrated database retrieval system