KEGG   Leishmania mexicana: LMXM_24_1630Help
Entry
LMXM_24_1630      CDS       T02288                                 

Definition
(RefSeq) putative succinate dehydrogenase flavoprotein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lmi  Leishmania mexicana
Pathway
lmi00020  Citrate cycle (TCA cycle)
lmi00190  Oxidative phosphorylation
lmi01100  Metabolic pathways
lmi01110  Biosynthesis of secondary metabolites
lmi01130  Biosynthesis of antibiotics
lmi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LMXM_24_1630
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LMXM_24_1630
Enzymes [BR:lmi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LMXM_24_1630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 13448939
NCBI-ProteinID: XP_003875980
UniProt: E9AX08
LinkDB All DBs
Position
24
AA seq 607 aa AA seqDB search
MLRRTFTRLALSRAYPVIDHTYDCVVVGAGGSGLRAAMGVAASGYDVACISKLYPSRSHT
IAAQGGINAALANCEEDDWRWHVYDTVKGSDWLGDQDAIQYMCQEAPCVVSELESMGLPF
LRTKDGFIYQRAFGGQSIHYGGKQARRTCAASDRTGHAMLHTLYGQSFQYGVNFYNEYYC
LDLIMEDGCCRGVMAMSIDDGTIHRFRSKYTVLCTGGYGRVYFTTTSAKSCTGDGTAMVA
RAGLPAEDMEFVQFHPTGIYGPGVLITEGARGEGGYLVNSEGERFMERYAPKAKDLASRD
VVSRAITMEILAGRGCGPKKDHVMLQLHHLDPATLHKKLPGISESAHIFAGVDVTKEPIP
IVPTVHYSMGGVPTLWTGEVVSPRNGDDNAIVPGLLAAGECACASVHGANRLGANSLLDI
VVFGKSCANTVIFNLTKEGRKQPELRADAGEASIADLDRILSNKGDIPIARIRERMKETM
ALYAAVFRTEESMQTGKRIIEECYRDFSHALVHDKSPVWNSNLIEALELRNLLTNAMMTI
SGAVVRKESRGAHARDDYQERDDHNWMKHTLAYLDDAKGKVRLAYRPVHMEMLTNEVESI
PPAKRVY
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcacctttacgcgtcttgcccttagccgcgcctacccggtcatcgaccac
acgtacgactgcgtcgtcgtgggcgccggtggctctggtctccgcgcggccatgggtgtg
gcggcctctgggtacgatgtggcgtgcatctcgaagctgtacccgtctcgctcacacacg
atagcggcgcagggtggcattaacgctgccctcgccaactgcgaggaggatgactggcgc
tggcatgtgtacgacacagtaaagggctcggactggcttggtgatcaggatgcaatccag
tacatgtgccaggaggccccatgcgttgtgtcggagctggagagcatgggcttgcccttc
ctgcgcacgaaggacggcttcatctaccagcgcgcctttggtggccagtcgatccactac
ggtggcaagcaggcgcgccgcacctgcgcggcgtcggaccgcacgggccacgccatgctt
cacaccctgtacggccagtccttccaatacggcgtgaacttctacaacgaatactactgc
cttgacctgatcatggaggatggctgctgccgcggtgtgatggccatgagcatcgacgac
ggcacgatccaccgcttcaggtccaagtacacggtgctctgcacgggtggctacggccgc
gtgtacttcacgacgacaagcgcgaagagctgcacgggcgacggcacggccatggtggcg
cgcgccggcctgccggcggaggacatggagtttgtgcagttccaccccaccggcatctac
ggccccggcgtgctcatcactgagggcgcgcgcggcgagggtggctaccttgtgaacagc
gagggtgagcgctttatggagcgctacgcccccaaggcgaaggatctggcgtcgcgcgat
gtcgtgtcgcgggccattacgatggagatcctggcgggtcgcggctgcggccccaagaag
gaccacgtgatgctgcagctacaccacctcgaccccgccactctgcataagaagctgccg
ggcatctcagagagcgctcacatcttcgccggcgttgacgtgaccaaggagccgattccc
attgtgccaacggtgcactactcaatgggcggcgtgccaacactgtggacgggcgaggtg
gtcagcccgcgcaacggtgacgacaacgcgatcgtgcccggcctgctcgccgctggggag
tgcgcctgcgctagcgtgcacggcgccaaccgcctcggcgcgaattcgctgctggacatt
gtcgtgttcggcaagtcgtgcgccaacacggtcatcttcaacctgacgaaggagggccgc
aagcagcccgagctgcgcgccgacgccggcgaggcctcaatcgccgatctggaccgcatc
ctcagtaacaagggcgacatccccattgcccgcatccgtgagcgtatgaaggagacgatg
gcgctctacgccgccgtattccgcacagaggagagcatgcaaacgggaaaaaggataatc
gaggagtgctaccgcgacttctctcacgccttggtgcacgacaaatcaccggtgtggaac
agcaacctcatcgaggcgctcgagctgcgtaacctgctgacgaacgccatgatgacgatt
agcggcgctgtggtgcgcaaggagagccgcggtgcccacgcgcgtgacgactaccaagag
cgtgacgaccacaactggatgaagcacaccctcgcataccttgacgacgccaagggcaag
gtacgccttgcgtaccgcccggtgcacatggagatgctgacgaatgaggtggagagcatc
ccgccagcgaagcgagtgtactag

DBGET integrated database retrieval system