KEGG   Lautropia mirabilis: NCTC12852_00018Help
Entry
NCTC12852_00018   CDS       T05799                                 

Gene name
gsiA_1
Definition
(GenBank) Glutathione import ATP-binding protein GsiA
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
lmir  Lautropia mirabilis
Pathway
lmir02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmir00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NCTC12852_00018 (gsiA_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmir02000]
    NCTC12852_00018 (gsiA_1)
Transporters [BR:lmir02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    NCTC12852_00018 (gsiA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 AAA_16 SMC_N AAA_22 AAA_29 DUF87 AAA_5 ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: VEG98953
LinkDB All DBs
Position
1:complement(23967..25766)
Genome map
AA seq 599 aa AA seqDB search
MTDTPKPLLVADALDVIFDTYRGPHQVLHQVSFHIAPGEILGVVGESGAGKSMTGLAVAG
LIEAPGRLAHGSVTLEGVRIDTLQGDAIRRLRGRRIGMVFQDPLTSLNPVLTIGQQLTET
IRTHLPLSERQATERALALLAEVEIPQPEWRLSQYPHQLSGGMRQRVAIALALCADPCLL
IADEPTTALDVSVQAQIIALLRRLCRQRGLSAMLITHDMGVIAETADRVMVMYGGRVLET
GPVRQVLQHPRHRYTRALMAAIPSVTRRQHRLPVPGVATSSSEMDDGNVPQSLSEVDDGA
PQWQAQPPKAVESASAADQSEEADAGTPLLAVENLSRRFDLSSGWLQRLLSREPRRILQA
VDNVGFTITRGRTFGLVGESGSGKSTVARMVAGLLKPDSGRIVFEGIDRWSRDAARLPAE
RRLALRRRCQMIFQDPYASLNPRWRVARLIAEPLHVLGLATDHDEIEARVIDMLRHVRMS
PDDARKYPHQFSGGQRQRIAIARALISQPDFIICDEPTSALDVSVQAQVLNLMRDLQDEY
GLTYLLISHDLAVIRFMCDDIGVMQQGRMVEQGRAQAVLDDPQDPYTRQLLAAIPSLGV
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgacagacaccccgaaacccctgctggtcgccgatgcgcttgatgtcatcttcgacacc
taccgcggcccgcaccaggtgctgcaccaggtctcgttccatattgcaccgggcgaaatt
ctcggtgtggtcggtgaatccggtgccggaaaatcgatgaccggtctggccgttgccgga
ctcatcgaggcgccgggccggctggcgcacggtagcgtcacgctggaaggtgtgcgcatc
gatacgctgcagggagatgccatccgtcgcctgcgtggccgacgcatcggcatggtgttt
caggatccgctcaccagcctcaacccggtgctcaccatcgggcagcagctcaccgagacc
attcgcacccacctgccgctgtccgagaggcaggccaccgaacgggcgcttgccctgctg
gccgaagtcgagattccgcagcccgagtggcggctctcccagtatccgcaccagctctcc
ggcggcatgcgtcagcgtgtggccattgccctggcgctgtgtgccgacccctgcctgctg
attgccgacgaacccaccaccgcactggatgtttccgtgcaggcgcagatcattgcgctg
ctgcggcgtctctgccgtcagcggggcctgtcggccatgctcatcacccacgacatgggc
gtcattgccgagaccgcggaccgcgtgatggtgatgtacggtggtcgtgtcctggaaacg
ggcccggtccgccaggtgctgcagcacccccgtcaccgctatacccgggcgttgatggcc
gccatcccttccgtcacccgacgccagcaccgcctgcctgtgccaggtgtcgcaacgtcg
tcgtccgagatggatgatggcaacgtgccgcaatcattgtctgaggtggatgacggcgcc
ccgcaatggcaggcccagcccccgaaggctgtcgaaagtgcgtcagccgctgatcaatcc
gaggaagcggatgccggcacgccactgctcgctgtcgagaacctctctcgtcgcttcgat
ctgtcctcgggctggttgcagcgcctgctctcgcgtgagccccggcgcatcctgcaggcc
gtcgacaatgtgggcttcaccatcacgcgcggccgcaccttcggtctggtcggtgagtcc
ggttcgggcaagtccaccgttgcccgcatggtggccgggctgctgaaaccggacagtggg
cgcatcgtcttcgagggcatcgatcgctggagtcgtgacgccgcgcgcttgccggccgaa
cgacggctcgccttgcgccgccgctgccagatgatctttcaggatccctacgccagcctg
aatccgcgctggcgtgtggcccggctcatcgccgaacccttgcacgtgctggggctggcc
acggatcacgatgaaatcgaggcacgcgtcatcgacatgctgcgccatgtacgcatgtcg
ccggatgatgcacgcaagtatccacaccagttctccggcggacagcgccagcgcatcgcc
attgcccgtgccctcatcagtcagccggatttcatcatctgcgacgagcccacctcggcc
ctggatgtttcggtgcaggcccaggtactcaacctcatgcgtgacctgcaggacgagtat
ggcctgacctatctgctcatcagccatgacctcgctgtcatccgcttcatgtgtgatgac
attggtgtcatgcagcagggacggatggtggagcagggcagggcgcaggccgtgctggac
gacccgcaggatccctacacccgtcagttgctggccgccatcccgtccctgggcgtctga

DBGET integrated database retrieval system