KEGG   Lautropia mirabilis: NCTC12852_00666Help
Entry
NCTC12852_00666   CDS       T05799                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lmir  Lautropia mirabilis
Brite
KEGG Orthology (KO) [BR:lmir00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC12852_00666 (ahpF)
Enzymes [BR:lmir01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC12852_00666 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_binding_3 DAO FAD_oxidored Glutaredoxin K_oxygenase NAD_binding_8 AlaDh_PNT_C Thi4 FMO-like Thioredoxin_4 NAD_Gly3P_dh_N RBFA Thioredoxin_9 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: VEH00283
LinkDB All DBs
Position
1:complement(831738..833306)
Genome map
AA seq 522 aa AA seqDB search
MLDADLKNQLQTYLGHLKQPIELVATLDGSPKAKEMQELLQEIAELSDKITLREDPAADV
RKPSFAINRIGTDIGVRFAAIPLGHEFTSLVLALLHVGGHTIKLDADTIEQTKALSGDYD
FEIYMSLSCQNCPDVVQALNSMSVINPRIRVQTIDGALFQDEVEKRAIMAVPTVFLNGEV
LFQGRSSAEEILARLDSGAHSRAAEKLSEKDPFDVLIVGGGPAGAAAAVYAARKGIRTGV
VAERFGGQVLDTMSIENYISVLETDGPKFAAALEAHTRHYGVDIMNLQKVESISRDEAAG
MVTVKTASGASLKSKTVILATGARWRSMGVPGEQEYRNRGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGVVDHVTLFEFMPELRADAVLQRKLESLPNVKILKNVQVTEVKASN
DKVSAIVYKDRTNDSIHEVALEGVFVQIGLVPNTDFLKDSGITLVRNGEIQVDVRGQTSM
EGVFAAGDCTTSPYKQIIIAAGDGAKAALAAFDHLIRTSAPK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgcagacctcaagaaccagctgcaaacctacctgggccacctgaaacagccg
atcgagctggtggccaccctggacggcagtccgaaagcgaaagaaatgcaggaactcctg
caggaaatcgccgaactgtccgacaagatcactctgcgcgaagacccggccgcggatgtc
cgcaagccctccttcgccatcaaccgcatcggcaccgacatcggcgtgcgctttgccgcc
atcccgctgggccacgagttcacctcgctggtgctggccctgctgcacgtcggcggccac
accatcaagctcgacgccgacaccatcgagcagaccaaggccctgtccggcgactacgac
ttcgagatctacatgtctctgtcgtgccagaactgcccggacgtggtgcaggcgctcaat
tcgatgtcggtcatcaacccccgcatccgcgtccagaccatcgacggcgccctcttccag
gacgaagtggaaaaacgcgccatcatggccgtgcccaccgtcttcctgaacggcgaagtg
ctgttccagggccgctccagcgccgaagagatcctggcgcgcctggacagcggcgcccac
tcccgcgccgccgagaagctctccgagaaggatcccttcgacgtgctgatcgtcggcggt
ggcccggccggtgctgcggcagccgtctacgccgcccgcaagggcatccgcaccggcgtg
gtggccgagcgtttcggcggccaggtgctggacaccatgtccatcgagaactacatctcg
gtgctggaaaccgacggtcccaagtttgccgccgccctggaagcccacacccgtcactac
ggcgtcgacatcatgaacctgcagaaggtcgagtcgatcagccgtgacgaggctgccggc
atggtcaccgtcaagaccgccagcggcgccagcctcaagagcaagaccgtcatcctggcc
accggtgcccggtggcgcagcatgggcgtgcccggcgagcaggaataccgcaaccgcggc
gtcacctactgcccgcactgcgacggcccgctcttcaagggcaagcgcgtcgccgtcatc
ggcggtggcaactcgggtgtcgaggccgccatcgacctggctggcgtggtggaccatgtc
acgctcttcgagttcatgcctgaactgcgtgccgacgccgtgctgcagcgcaagctggaa
agcctgcccaacgtgaagatcctgaagaacgttcaggtcaccgaggtcaaggccagcaac
gacaaggtcagcgccatcgtctacaaggaccgcaccaacgacagcatccacgaagtggcg
ctggaaggcgtgttcgtccagatcggcctggtgcccaacaccgacttcctgaaggacagt
ggcatcacgctggtccgcaacggcgagatccaggtcgacgttcgtggccagacctcaatg
gaaggcgtgtttgccgccggtgactgcaccacctcgccgtacaagcagatcatcatcgct
gccggcgatggcgccaaggctgccctggcagccttcgatcacctgatccgcacctcggca
cccaagtaa

DBGET integrated database retrieval system