KEGG   Lautropia mirabilis: NCTC12852_00671Help
Entry
NCTC12852_00671   CDS       T05799                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lmir  Lautropia mirabilis
Pathway
lmir00564  Glycerophospholipid metabolism
lmir01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmir00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCTC12852_00671 (glpD)
Enzymes [BR:lmir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NCTC12852_00671 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 HI0933_like FAD_binding_3 NAD_binding_8 GIDA Pyr_redox_3 Pyr_redox Thi4 Trp_halogenase Lycopene_cycl GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: VEH00293
LinkDB All DBs
Position
1:838649..840220
Genome map
AA seq 523 aa AA seqDB search
MQRNKAIEQLRTHGEWDVVVIGGGATGLGVAVDAATRGYSTLLLEAHDFAKGTSSRSTKL
VHGGVRYLAQGYVDLVREALRERGRLSHNAPHLFRKQAFIIPGEKWWTAPYYTFGLWMYD
RLSGKLSIGKTRYLGQGDARRRLKGVRDDKIGAGVCYYDGQFDDARLALCLAQTATDHGA
TVLNYCAVTALKKGGNGRLEGVTAKDELTGETFEVKAKCVVNATGVFANPILGMDEPHDK
PPILPSQGIHLVLDREFLPGEDALMVPKTSDGRVLFAVPWHGKVVVGTTDTLVKDPSYEP
LPLEQEIEFILNTSRDYLTKAPTRADVRSVYVGLRPLAAPKDEGKSTKEVSRSHKVEVSH
SGMVNIFGGKWTTYRQMAEDGVDAAIGAGLLPAKPCRTQELRLHGYIDDKQHMDDTPLTL
YGSDAMAIGRLIAAEPKLADRIHPAYPFTFAQVQWAIDEEVAQSLEDVLARRIRLLFLDA
KAAEAAAPAVAAFMAPRLGWSEERQKAELDNFVKLTKQYRLVA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcaacaaggccatcgaacagctcaggacccacggtgaatgggatgtggtggtg
attggcggtggtgcgacgggcctcggggtggcggtggatgccgccacccgcgggtattcc
accctgctgctcgaagcccacgactttgccaagggcacgtccagccggtccaccaagctg
gtgcatggtggcgtgcgctacctggcccagggctatgtggacctggtgcgcgaggcgctg
cgcgagcgtggccgtctctcgcacaatgcgccgcacctgttccgcaagcaggctttcatc
atcccgggcgaaaaatggtggacggcgccgtactacaccttcggcctgtggatgtatgac
cgtctctccggcaagctgagcatcggcaagacccgctatctgggccagggcgatgcccgc
cggcgtctgaagggggtgcgtgacgacaagatcggtgccggggtctgctactacgacggc
cagttcgacgacgcccgtctggcgctgtgcctggcacagacggccaccgaccatggtgcc
acggtgctcaactactgcgccgtcacggcgttgaagaagggcggcaatggtcgtctggaa
ggcgtgacggcgaaggacgagctgaccggcgagaccttcgaggtgaaggcgaagtgcgtg
gtcaacgccaccggcgtgtttgccaaccccatcctggggatggacgagccgcacgacaag
ccgcccatcctgcccagccagggcatccacctggtgctggaccgcgagttcctgcccggc
gaggacgccctgatggtgcccaagacatcggacggccgcgtgctgtttgccgtgccctgg
catggcaaggtggtggtgggtaccaccgacaccctggtcaaggatccgtcttacgagccg
ctgccgctggaacaggaaatcgagttcatcctgaacacgtcgcgcgactatctcacgaag
gcccccacccgggccgacgtgcgcagcgtctacgtggggctgcgcccgctggccgcaccc
aaggacgagggcaagtccaccaaggaagtgtcgcgcagccacaaggtggaggtcagccac
tccggcatggtcaacatcttcggcggcaagtggaccacctaccgccagatggccgaggac
ggcgtggatgccgccatcggtgccgggctgctgccagccaaaccctgccgcacgcaggaa
ctgcgcctgcacggctacatcgacgacaagcagcacatggacgacacgccgctgacgctg
tacggcagtgacgccatggccatcggcaggctgatcgccgcagagccgaagctggccgac
cgcatccaccccgcctaccccttcaccttcgcccaggtgcagtgggccatcgatgaagag
gttgcccagtcgctggaagacgtgctggcacggcgcatccggctgctgttcctggacgcc
aaggcggccgaggctgcagcgcctgcggtggctgcattcatggccccccggctgggctgg
agcgaggagcgccaaaaggccgagctggacaacttcgtcaagctcacgaagcagtatcgg
ctggtggcctga

DBGET integrated database retrieval system