KEGG   Lautropia mirabilis: NCTC12852_01468Help
Entry
NCTC12852_01468   CDS       T05799                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lmir  Lautropia mirabilis
Pathway
lmir00061  Fatty acid biosynthesis
lmir00780  Biotin metabolism
lmir01100  Metabolic pathways
lmir01130  Biosynthesis of antibiotics
lmir01212  Fatty acid metabolism
Module
lmir_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lmir00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCTC12852_01468 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NCTC12852_01468 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NCTC12852_01468 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lmir01004]
    NCTC12852_01468 (fabI)
Enzymes [BR:lmir01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NCTC12852_01468 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NCTC12852_01468 (fabI)
Lipid biosynthesis proteins [BR:lmir01004]
 Fatty acid synthase
  Component type
   NCTC12852_01468 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: VEH01842
LinkDB All DBs
Position
1:complement(1816348..1817142)
Genome map
AA seq 264 aa AA seqDB search
MNTGFLAGKRILILGLLSNRSIAYGIAKQCRAQGAELAFTYQNDRFKDRITEMAAEFGSS
LVFPCDVAEDEQIDALMKSVGQHWTDGFDGLVHAIAYAPREAIAGDFLEGATRENFRMAH
DISAYSLVALARAALPLMQGRNGALVTLSYLGAVRAVPNYNTMGVAKASLEASVRYLARS
LGPKGIRANGISAGPIKTLAAAGIKGFSSILAAVEAAAPLHRNVTIEEVGNAAAFLLSDL
ASGITGEITYVDAGYSNALGGVEG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaggttttctggccggcaagcgcatcctcatcctcggcctgctctccaatcgc
tcgattgcctacggcattgccaaacaatgccgcgcccagggcgccgagctggctttcacc
taccagaacgaccgcttcaaggaccgcatcaccgaaatggcggcggaattcggctcctcg
ctggtcttcccctgcgacgtggctgaagacgaacagatcgacgccctgatgaagagcgtt
ggccagcactggaccgatggcttcgacggccttgtccacgccatcgcctatgctccccgc
gaagccattgccggcgacttcctggaaggcgccacccgcgagaacttccgcatggcccac
gacatctcggcctacagcctggtggccctggcccgcgctgccctgccgctgatgcaaggg
cgcaacggtgccctcgtcacgctcagctacctgggcgccgtgcgtgccgtgcccaactac
aacaccatgggcgtggccaaggcctcgctggaagccagcgtccgctacctggcccgctcg
ctggggcccaagggcatccgcgccaacggcatctccgccggccccatcaagaccttggct
gccgccggcatcaagggcttctccagcatcctggcagccgttgaagccgccgccccgctg
caccgcaacgtcaccatcgaggaagtgggcaacgccgccgccttcctgctgtctgacctc
gcctccggcatcaccggcgagatcacctacgtggacgcgggctactccaacgccctgggt
ggcgtggaaggctga

DBGET integrated database retrieval system