KEGG   Lautropia mirabilis: NCTC12852_02504Help
Entry
NCTC12852_02504   CDS       T05799                                 

Definition
(GenBank) Probable ABC transporter ATP-binding protein HI_0664
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
lmir  Lautropia mirabilis
Pathway
lmir02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lmir00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NCTC12852_02504
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmir02000]
    NCTC12852_02504
Transporters [BR:lmir02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    NCTC12852_02504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DLIC RsgA_GTPase ABC_membrane AAA_16 AAA_29 AAA_33 MMR_HSR1 DUF87 AAA_22
Motif
Other DBs
NCBI-ProteinID: VEH03773
LinkDB All DBs
Position
1:3053834..3055591
Genome map
AA seq 585 aa AA seqDB search
MTGKDDPLTGKDAPVTERDSAAKDGMAHRSSLPALKAMCDGASTRMKWGAALAAVTVLAG
MGLLGLSGWFITATAIAGLQPATALAFDVFAPSAGIRLLALGRTVSRYGERLVTHDATLA
ALAQLRERLFRGWAESTSIQDLLRRPARALFRLTTDLDALDAFYLRLLVPAAAALGATLL
ATVVVGVMSPWLGLALGGWMLIIGLAVIIVLARRSRRPATRRALLTERLRAQAVDLVSGQ
TELLMAGRLAAQRDTLRRTDERLARSDRRLQRLDAKAAAIHGVAGSLTLALVLLGVGLLA
EQGQIGTPEAALALLIALTAMEPFAALRRGALESGRAWLAARRLSPHCAPTVQPPAQRPD
TGCAIIVDDVSVRHPDSPVDALTALSLKLAAGERVAVVGPSGAGKSTLMALIAGERHPHT
GRVLTQPGAWLNQRPDLFQDSLRDNLRLADPDADDAALWQALEAAGLADAIRRLQAGLDT
RLGEGGLGLSAGQARRLALARLLLQKRPLWLLDEPTEGLDAATAADVLARLDTLGQGRAW
LMAAHLRREAALADRLLVLRNGRLEGEFRRGSEGFEAALAALRPD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaaaggacgacccgctaacagggaaagacgccccggtgaccgagagggacagc
gcggcgaaggatggcatggcccatcgttcctccctgcccgccctgaaggcgatgtgcgac
ggcgcgtcgacacgcatgaaatggggcgccgcgctggctgccgtgacggtgctggccggc
atgggcctgctgggcctgtcgggatggttcatcacggcaaccgccattgccgggctgcag
cccgccaccgcgctggccttcgatgtctttgcgccatctgccggcatccggctgctggcg
ctggggcgcaccgtgtcccgctatggcgagcggctcgtcacccatgacgccaccctggcg
gcgctggcgcaactgcgcgaacgcctcttccgcggctgggcagagagcaccagcatccag
gacctgctgcgccgtccggcacgggccctgttccggctgaccacggacctggatgcgctg
gacgccttctatcttcgcctgctggtgccggccgccgcggcgctgggtgcgacgctgctg
gccacggtcgtggtcggcgtgatgtcgccctggctcggcctcgcgctgggcggctggatg
ctgatcatcggcctggccgtgatcatcgtgttggcccgccgctcgcggcgccccgccaca
cggcgggccctgctcacggaaaggctgcgcgcccaggccgtggacctggtgtcgggccag
acggaactgctcatggccggccggctggccgcccagcgagacaccctgcgccgcacggat
gaacgtctggcgcgcagtgaccgtcgtctgcagcgactggacgcgaaagcggccgccatc
catggtgtggccggcagcctcacgctggccctggtcctgctgggtgtgggcctgctggcc
gaacaggggcagatcggcacgccggaagcagccctggcgctactgattgcgctgacggcc
atggaaccctttgcggcgctgcgtcggggagcactcgaatcgggccgcgcctggctggcg
gctcgtcggctttccccccactgcgcgccgaccgttcagccccccgcccaacgccctgac
acgggctgtgcgatcatcgtggatgacgtgtcggtccgtcatccggacagccctgtggat
gcactgaccgcactgtcgctgaagctggccgcgggcgaacgggtcgccgtggtcggcccc
agcggcgcaggcaagtcgacactgatggcgctgatcgccggagagcgccatccgcacacc
gggcgcgtcctgacgcagcccggcgcctggctgaaccagcgtccggacctgttccaggac
agcctgcgcgacaacctgcgcctggccgacccggacgcggacgacgccgcactgtggcag
gccctggaagcagccggtctggcggacgccatacggcgcctgcaggccgggctggacacg
cgactgggcgaaggcggcctggggctgtcggccggccaggcccgccgcctggcgctggcc
cgactgctgcttcagaagcgccccctgtggctgctggatgagccgaccgaggggctggat
gccgccacggccgccgatgtgctggcccgactggacacgctgggccaagggcgtgcatgg
ctgatggccgcccatctgcgccgcgaagcggcgctggccgatcgcctgctggtgctgcgc
aacggcaggctcgaaggtgaattccggcgcggcagcgagggcttcgaggccgcgctggct
gcgctgagacccgattga

DBGET integrated database retrieval system