KEGG   Listeria monocytogenes J0161: LMOG_02260Help
Entry
LMOG_02260        CDS       T01987                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00040  Pentose and glucuronate interconversions
lmj00051  Fructose and mannose metabolism
lmj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMOG_02260
   00051 Fructose and mannose metabolism
    LMOG_02260
Enzymes [BR:lmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LMOG_02260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C PALP 2-Hacid_dh_C PrmA TrkA_N Pyr_redox_2 UDPG_MGDP_dh_N Methyltransf_25 HAD ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AEO02589
LinkDB All DBs
Position
549432..550478
Genome map
AA seq 348 aa AA seqDB search
MKALKLYGKRDLRYEEADMPTIEEPDDVILKVKTVGICGSDISRYSKLGPYVPGMVWGHE
FSGEVIEVGSEVTDIEIGDRAAGCPALYCGECEYCKKGEFARCRKLTVIGARHPGAYAEY
IKLPAENVVKIPDELDYEAAALVEPSAVVVHGFYHTKLQAGDDVVVVGSGNIGLLAIQWA
KVFGARRVIAIDVDDKKLALAKEVGADVVINSLKEDPLEVVAAHTDGLNADLVVEAAGSP
ITSAQVFAYAKKGGGVVFLGIPYADVTIERFYFEKIVRSELTVWGSWNAISAPFPGKEWQ
TTIHFLANKQINIEPMITHRLSLAEGPEVFERIYERNEFFGKVLFFPE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttaaaattatatggaaaaagagatttgcgttatgaagaagcggatatgcca
acaattgaagagccagatgatgttattttgaaagtgaaaacagttgggatttgtggctca
gatatttcaaggtatagtaagcttgggccgtacgtaccaggaatggtatggggtcatgaa
ttttcaggggaagttattgaagttggtagtgaggttacagatattgagattggtgatagg
gctgccggatgcccagcactctattgtggagagtgtgaatactgtaaaaaaggcgaattc
gcccgctgtcggaagctaacagtaatcggagcaagacatcccggagcctatgctgagtat
atcaaacttccagcagaaaatgtagtaaaaataccagatgaattagattatgaagctgct
gcacttgtcgagccttccgcagtggtcgttcatggattttatcatacgaaattacaagct
ggtgatgatgtcgtcgttgtcggaagcggcaatatcggtttgctagcaattcaatgggcg
aaagtctttggggcaagaagagtgatagcgattgatgtagacgataaaaagctagcactt
gcgaaagaagtcggagcagacgtagttattaactctttaaaagaagatcctttagaagta
gtcgcagcacatacagatggtctaaacgctgatttagttgtagaagctgcgggatcacct
attacatctgcacaagtttttgcctatgcgaaaaaaggtgggggcgtcgttttcctagga
attccatacgcagatgtaacaatcgaacgtttctattttgaaaaaattgtacgtagtgag
cttactgtttggggctcatggaatgcaatttctgcaccattcccaggaaaagaatggcaa
acaaccattcacttcttagccaataaacaaatcaacattgagccaatgattacacatcgt
ctttcacttgctgaaggaccagaagtttttgagcgaatctatgaaagaaatgaatttttc
gggaaagtattatttttcccagaatga

DBGET integrated database retrieval system