KEGG   Listeria monocytogenes J0161: LMOG_02433Help
Entry
LMOG_02433        CDS       T01987                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00250  Alanine, aspartate and glutamate metabolism
lmj00410  beta-Alanine metabolism
lmj00430  Taurine and hypotaurine metabolism
lmj00650  Butanoate metabolism
lmj01100  Metabolic pathways
lmj01110  Biosynthesis of secondary metabolites
lmj01120  Microbial metabolism in diverse environments
lmj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LMOG_02433
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOG_02433
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMOG_02433
   00430 Taurine and hypotaurine metabolism
    LMOG_02433
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMOG_02433
Enzymes [BR:lmj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMOG_02433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AEO04532
LinkDB All DBs
Position
complement(2511571..2512974)
Genome map
AA seq 467 aa AA seqDB search
MLYSEDDKRKQESYRIPLFGSEEESTSIPKYVLKKEPMEPRIAYQLVKDQLMDEGNARQN
LATFCQTYMEKEAEILMAETLEKNAIDKSEYPQTAELENRCVNILADLWNAPKDMSYLGT
STVGSSEACMLGGLAMKFRWRNNAEKRGLDIQAKRPNLIISSGYQVCWEKFCVYWDVDMR
VVPMDKNHLSLDVDKVFDLVDEYTIGVVGILGITYTGKFDDIQLLDEKVEAYNATNEHQL
VIHIDGASGAMFTPFVNPELPWDFRLKNVVSINTSGHKYGLVYPGVGWILWKDKEYLPKE
LIFEVSYLGGSMPTMAINFSRSASQIIGQYYNFLRYGFEGYREIHEKTKKTALYLAKTVE
KSGYFEIINDGANLPIVCYKMKEGLDVEWTLYDLADQLLMKGWQVPAYPLPADLSDTIIQ
RFVCRADLGYNVAEEFAADFADAIHNLEHARVLYHDKERNDSYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctttatagtgaagacgacaagcgaaaacaggaaagttatcgaatcccactctttgga
tctgaggaagaaagcacgagtatcccgaaatacgtattaaaaaaggagccgatggaacct
cgcattgcttatcaacttgtaaaagatcagttgatggatgagggaaatgcgcggcaaaac
ttagcgactttttgtcagacatacatggaaaaagaggcagaaatactgatggcagaaacg
ctcgagaaaaatgcaattgataaatctgaatatccacaaacggctgaactggaaaatcgg
tgcgtcaatatattagctgatttgtggaatgctccaaaagatatgtcttacttggggact
tcgacagttgggtcttcggaagcttgtatgctaggcggtttggcaatgaagtttcgctgg
cgtaacaatgcggaaaaacgaggtctggatatacaggcaaaacgaccaaacttaattatt
tcatcaggttaccaagtatgttgggaaaaattctgtgtatactgggatgtcgatatgcgt
gttgtaccaatggataaaaaccaccttagtcttgatgtggacaaagtgtttgatttggtt
gatgagtatacaattggggttgtcgggattttaggcattacttatactggtaaatttgat
gatattcaattattagatgaaaaagtagaagcatacaatgcaacaaacgaacatcaatta
gtcattcatattgacggagcaagtggcgcgatgtttacaccatttgtaaatccggaatta
ccttgggatttccgtcttaaaaatgttgtgtctataaatacttccggtcataaatacgga
ttagtttatccgggtgttggttggattttgtggaaagacaaagaatatttaccgaaagag
cttatttttgaagtcagctacttaggtggttcgatgccgacgatggcgattaacttctct
cgtagtgcgagccaaattattggtcaatattataatttcttacgatatggttttgaaggt
tatcgagaaattcatgaaaaaacaaagaaaacagccctttacttggcaaaaactgtagaa
aaaagtggctattttgaaattattaatgatggcgctaatttaccgattgtttgttacaaa
atgaaagaaggactggatgtagagtggacgctatatgacttggctgatcagcttttgatg
aaagggtggcaagttccagcctatccacttccggctgatttaagtgatacgattattcaa
cgatttgtttgccgggcggacttaggctataacgtggcagaagagtttgccgctgacttt
gcagatgcgattcataatctggaacatgctagagtgctgtatcatgacaaagaacgcaac
gattcatacggatttacgcactaa

DBGET integrated database retrieval system