KEGG   Leuconostoc mesenteroides KFRI-MG: LMES_0768Help
Entry
LMES_0768         CDS       T02997                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
lmk  Leuconostoc mesenteroides KFRI-MG
Pathway
lmk00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LMES_0768
Enzymes [BR:lmk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LMES_0768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C ABC_transp_aux
Motif
Other DBs
NCBI-ProteinID: AHF18984
LinkDB All DBs
Position
825903..827924
Genome map
AA seq 673 aa AA seqDB search
MNKNKELLFGVAYYFEYLPYDRIDQDIKMMQEAKINVVRIGESTWSTYEPQDGVFDFSKL
IYTLNKMRDAKISVIVGTPTYAFPTWLARKFPEVLVENNGNRLPYGARQIMDITSPIYRY
YSERIIRHMLQETVDYDNIIGYQVDNETKHYGTSASHVQAGFVEEIKEKFSGDLDTFNKE
FGLDYWSNRINTWEDFPNVNGTINGSLAGEFAKYQRSLVKEYLSWQVDLVNEYKKDFQFV
THNFDFEWRDYSYGIQPDVNHFEAAEPLDFVGIDVYHPSQSQLTGIENSFAGDVARSIKH
QNYLVLETQAQAFKSWTPYPGQLYQLAFNHIANGANMIEYWHWHSIHNSFETYWKGLLSH
DFEPNPVYEEAQKVGHDFDRLSDKLVNLNHAADVAFVVDNESLTATSSDWIEFAIGKDVN
YNDVFRRLYDTFYKLNVRTDILNPKTINLSDYALVVVPMLYVSDETFLKALNQYIHDGGN
VLFTFKDGVTDEHVKVRTDIQPAIIREAIGAHYHMFVDPNGETLEDQTGIFEDTDLHISE
WAELLESDGATILASYNNHWKKFGAITENKYGNGMAWYLGAWPSQSVTNALVKHVINQSG
ISQSDYDVTFPVIVKSAKNEYGANIDFLFNFSDTSTSLATPFSGMELIKQEHMAQGSQVT
LQPWDVKIIERSN
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaataaggaattattgtttggcgttgcctattattttgagtatttgccctac
gatcgtattgatcaagatatcaaaatgatgcaagaagctaaaattaatgtcgtcagaatt
ggagaaagtacttggagtacctacgaaccacaagatggtgtatttgattttagcaaactg
atttatacgctaaataaaatgagggatgcaaagatatcggttattgtgggcacgccgacg
tatgcatttcctacttggttggctaggaagtttcctgaggtgcttgttgaaaataatggg
aaccggctaccttacggtgccaggcagataatggatattaccagtccaatttatcgatat
tattctgagcgaatcattcgtcatatgttgcaggaaacggttgattacgacaatatcatt
ggctatcaagtcgataatgaaaccaagcactatggcacatctgcaagtcacgtacaggcc
ggctttgttgaagaaattaaagaaaaattttctggtgatcttgatacattcaataaagag
tttggtcttgactattggtcgaatcgtattaacacgtgggaggactttccgaatgtaaac
ggtacaattaacggcagtttagcaggtgagtttgcaaaataccaacgttcattagtgaag
gaatacttaagttggcaagttgacttggtcaatgagtataaaaaagattttcaatttgta
acacacaattttgattttgaatggcgtgattattcgtatggcattcaaccagatgtcaat
cattttgaagcagctgaaccgttagactttgtgggaattgacgtctatcatccctcacaa
agtcagcttacagggatagaaaattcttttgctggcgatgttgcgcgttcaattaagcat
caaaattatttagtgctagaaacgcaggcacaagcatttaaaagctggacaccatatcca
ggacaactttatcaacttgcttttaaccatatcgccaatggcgcgaacatgattgaatat
tggcactggcattctatccataattctttcgagacgtattggaaaggattactgagtcat
gattttgaaccaaatccagtttatgaagaggctcaaaaagtgggacatgactttgaccgt
ttgtctgataagttagtcaacttaaatcatgcagcagacgtagcgtttgtggtagataac
gaaagtctcacagcaacatctagtgattggatagagtttgcgattggaaaagacgtaaac
tacaatgatgtatttcgaagattgtacgatacattttacaaattaaatgtccgaaccgat
attttgaatccaaagacaattaatttgagtgattacgcattagttgtcgtaccaatgtta
tatgtcagtgacgaaacctttttgaaagcgttaaatcagtacattcatgacggtggcaat
gtattgttcacgtttaaagacggtgtgactgatgaacatgtcaaagtacggactgatata
caaccagcaattattcgagaagcaattggtgcgcattatcacatgtttgtcgaccccaac
ggtgagacattagaagatcaaactggcatatttgaagatactgatttgcacatcagtgag
tgggctgaattgctcgagagtgacggagcaacaattttagcctcatataataatcattgg
aaaaaatttggtgctattacagaaaacaaatatggtaatggtatggcatggtatttaggt
gcttggccaagccagtctgttacgaatgctctagtaaagcatgttatcaatcaatcagga
atttcccaatctgattatgatgtaacttttccagtgattgttaaatcagcaaaaaatgag
tacggcgcgaacattgattttctgttcaatttttcggatacgagtacaagccttgctacg
cctttctcaggtatggagctaatcaaacaagaacacatggctcaaggtagtcaagtgaca
ttgcaaccttgggatgtaaaaattatagaaagaagtaactga

DBGET integrated database retrieval system