KEGG   Listeria monocytogenes L99 (serotype 4a): lmo4a_0866Help
Entry
lmo4a_0866        CDS       T01989                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lml  Listeria monocytogenes L99 (serotype 4a)
Pathway
lml00473  D-Alanine metabolism
lml00550  Peptidoglycan biosynthesis
lml01100  Metabolic pathways
lml01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lml00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    lmo4a_0866 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lmo4a_0866 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    lmo4a_0866 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lml01011]
    lmo4a_0866 (ddlA)
Enzymes [BR:lml01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     lmo4a_0866 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:lml01011]
 Precursor biosynthesis
  Amino acid ligase
   lmo4a_0866 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST DUF2922
Motif
Other DBs
NCBI-ProteinID: CAR83568
LinkDB All DBs
Position
888019..889131
Genome map
AA seq 370 aa AA seqDB search
MKTKLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAAPIYITNEGEWIQGPLLSGKLDF
VEQLRFSATDSIKLATTESEKSEGEAISPAVLEADGQETVVFPLLHGPNGEDGTVQGLFE
VLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLIDWKNYQAEMITEMEEVL
TYPVFVKPANLGSSVGISKATNKKELADAMTEAFLYDRRVVVEQGVVAREIEMGVLGNDT
PVCSVPGEILPEGAVATFYDYKAKYQDNNTALIIPTEVDPEILEQMKEYAVQAFLGLDAS
GLVRADFFLTEDNQLFLNEVNTMPGFTPYSMYPLLWQETGLPYGALIERLVDLAKERHAA
KNALKYKLED
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaattaattttgttatacggtgggaaatctgctgaacacgaagtttcctta
caaacagcattttcagttatcaatgctttggatttagaaaaattcgaagctgcgccaata
tatattacgaatgaaggtgagtggattcaaggaccacttctttctgggaagttagatttt
gtcgaacaattacgtttttcggctacagattcaataaaacttgctacaactgaatcagaa
aaatcagaaggggaagcaattagcccggccgttttagaagcagacggacaagagacagtc
gtattcccacttttacatggtccaaacggagaagatggcactgttcaaggattgttcgaa
gtattaaacattccatatgttggcaacggggtcttggcatcttctgctgcaatggacaaa
atcgtgatgaagaaaatttttgcagatgctggtattccgcaagttccagcagttgcagtg
cgtttaattgattggaaaaactatcaagcagaaatgattacggagatggaagaagtactt
acctatccagtcttcgtaaaaccagcaaaccttggttcgagtgttggtattagtaaggca
acaaacaaaaaagaattagcggacgcaatgacagaagcatttttatatgaccgtcgtgtg
gttgttgaacaaggtgttgttgcgcgcgaaatcgaaatgggcgtacttggaaatgatacg
ccagtttgctctgttccaggtgaaattttgccagaaggtgcagttgctacgttttacgat
tacaaagcaaaataccaggataataatactgcgttaattattccgactgaagtagatccg
gaaatcttggaacaaatgaaagaatatgcggttcaagcattcctaggtcttgatgcaagc
ggactagtgcgagcggactttttcttaacggaagataatcagttattcttaaatgaagtg
aatacaatgccaggtttcacaccgtacagcatgtatcctcttctttggcaggaaacgggc
ttaccgtacggagcgttaattgaacgattagtcgatttagcgaaagaacgccacgcagcc
aaaaatgcacttaaatataaattagaagactaa

DBGET integrated database retrieval system