KEGG   Listeria monocytogenes L99 (serotype 4a): lmo4a_0985Help
Entry
lmo4a_0985        CDS       T01989                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lml  Listeria monocytogenes L99 (serotype 4a)
Pathway
lml00061  Fatty acid biosynthesis
lml00780  Biotin metabolism
lml01100  Metabolic pathways
lml01130  Biosynthesis of antibiotics
lml01212  Fatty acid metabolism
Module
lml_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    lmo4a_0985 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    lmo4a_0985 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    lmo4a_0985 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lml01004]
    lmo4a_0985 (fabI)
Enzymes [BR:lml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     lmo4a_0985 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     lmo4a_0985 (fabI)
Lipid biosynthesis proteins [BR:lml01004]
 Fatty acid synthase
  Component type
   lmo4a_0985 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: CAR83689
LinkDB All DBs
Position
1000686..1001474
Genome map
AA seq 262 aa AA seqDB search
MNLSLEGKTYVVMGVANKRSIAWAIARSLNEAGAKLVFTYADDRAKKSITELVPSLSEVN
QNPLILACDVTSEDAITETFETIKNKAGKLSGLAHCIAFANKDFLTGDYLEVDRKSFLQA
HEISAYSFTAVARALKHLEMLTEDASLLTLTYLGGERVVENYNIMGVAKASLDASVRYLA
MDLGAIGVRVNAISAGPIRTVSARGVSGFSDSISLVEERAPLKRATQAEEVGDTAYYLFS
NLSRGVTGEVIHVDSGYHIIGF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatcattagagggaaaaacatatgttgtaatgggagtagctaataagcgtagt
atcgcctgggccatcgctcgttcactaaatgaagctggagcgaaactggtatttacatat
gccgacgatcgtgcgaaaaaaagtattacagaactagtaccttcattaagcgaagtaaac
caaaatccacttatcttagcttgtgatgtaactagtgaagatgctattacagaaacattt
gaaacgattaaaaacaaagctggcaaattaagtggcttagcacattgtattgctttcgct
aacaaagactttttaactggagattatttagaagtagatcgtaaaagcttcttacaggca
catgaaattagtgcttactcattcacagctgttgctcgtgcgctaaaacacttggaaatg
ttaacagaagatgctagtttactaacgctaacgtacctaggcggagaacgcgtagtagag
aactacaatatcatgggtgttgcaaaagcttctcttgatgcaagcgttcgataccttgct
atggacttaggagcaattggtgtccgtgtaaatgctatttcagcaggaccaatcagaaca
gtatctgctcgtggtgttagcggcttctctgactctatttcactagtagaagaaagagct
ccattaaaacgcgcgacacaagcggaagaagttggcgacacagcttactacttattcagt
aatttatctcgtggtgttactggcgaagttattcatgtcgatagtggttatcatattatt
ggattctaa

DBGET integrated database retrieval system