KEGG   Listeria monocytogenes L99 (serotype 4a): lmo4a_2362Help
Entry
lmo4a_2362        CDS       T01989                                 

Gene name
gadG
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lml  Listeria monocytogenes L99 (serotype 4a)
Pathway
lml00250  Alanine, aspartate and glutamate metabolism
lml00410  beta-Alanine metabolism
lml00430  Taurine and hypotaurine metabolism
lml00650  Butanoate metabolism
lml01100  Metabolic pathways
lml01110  Biosynthesis of secondary metabolites
lml01120  Microbial metabolism in diverse environments
lml02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    lmo4a_2362 (gadG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lmo4a_2362 (gadG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    lmo4a_2362 (gadG)
   00430 Taurine and hypotaurine metabolism
    lmo4a_2362 (gadG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    lmo4a_2362 (gadG)
Enzymes [BR:lml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     lmo4a_2362 (gadG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: CAR85066
LinkDB All DBs
Position
2414028..2415422
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKDQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAQKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKDHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIYNDGSHLPIVCYKLKDDANVKWTLYDLADHLQMRGWQVPAYPLPKNLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatataccctcggaaaagaaccactcgaacctcggattgcc
tatcgtttagtaaaagatgaacttttagatgaaggttctgcccgccaaaacttagctact
ttttgccaaacatatatggaagacgaagcaaccaagttaatgtccgaaacactagaaaaa
aatgcgattgataaatccgaatatcctagaacagccgaactagaaaatcgttgcgtcaat
attatcgctgacttgtggcatgcacctaaagaccaaaaattcatgggaacttccacaatc
ggctctagtgaagcgtgtatgcttggcggaatggcaatgaaatttgcttggagaaaacgt
gcggaaaaacttggcttagatatttatgcgcaaaaaccaaacctcgttatctcttctggc
tatcaagtatgctgggaaaaattctgtgtctactgggatatcgatatgcgcgttgttcca
atggataaagaccacatgcaactaaatactgaccaagtccttgattacgtcgacgaatat
acaatcggcgttgtcggcatcctcggcatcacttacacaggccgctacgatgacatctat
gcacttaacgaaaaattagaagaatacaatagcaaaacagattataaagtctacattcac
gtcgatgcagcaagtggcggattcttcacaccatttgtcgaacccgatatcatctgggac
ttccgcttgaaaaacgttatctccattaatacttctggtcacaaatacggcctcgtttat
ccaggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaactcatcttt
aaagttagctatcttggcggagaaatgccaaccatgcaaatcaatttctcccgcagcgcc
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcaccaaaaaacaagcgatgtcgcacaataccttgctcatgcagtcgaacaaaccggc
tactttgacatttataacgacggctcccatttaccaatcgtctgctataaattaaaagac
gacgctaacgtaaaatggacattatatgatttagcggaccacctccaaatgcgcggctgg
caggttcccgcatacccactaccaaaaaacttagaaaacatcatcatccaacgttacgtc
tgccgagctgacctcggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgcccacattctcttccacgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system