KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_01070Help
Entry
MI1_01070         CDS       T01768                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
lmm00473  D-Alanine metabolism
lmm00550  Peptidoglycan biosynthesis
lmm01100  Metabolic pathways
lmm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lmm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MI1_01070
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MI1_01070
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MI1_01070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lmm01011]
    MI1_01070
Enzymes [BR:lmm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MI1_01070
Peptidoglycan biosynthesis and degradation proteins [BR:lmm01011]
 Precursor biosynthesis
  Amino acid ligase
   MI1_01070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AET29676
LinkDB All DBs
Structure
PDB: 

Position
218550..219683
Genome map
AA seq 377 aa AA seqDB search
MTKKRVALIFGGNSSEHDVSKRSAQNFYNAIEATGKYEIIVFAIAQNGFFLDTESSKKIL
ALEDEQPIVDAFMKTVDTSDPLARIHALKSAGDFDIFFPVVHGNLGEDGTLQGLFKLLDK
PYVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNWSWDKIVAELGNIVFVK
AANQGSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGARELEVGVIGNDQPLVSEI
GAHTVPNQGSGDGWYDYNNKFVDNSAVHFEIPAQLSPEVTKEVKQMALDAYKVLNLRGEA
RMDFLLDENNVPYLGEPNTLPGFTNMSLFKRLWDYSDINNAKLVDMLIDYGFEDFAQNKK
LSYSFVSLGEEKIGKFN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaagagtagcgcttatttttggaggtaattcctctgagcacgacgtatca
aagcgttcagcgcaaaatttctataatgcaatcgaagcaactggtaaatatgaaattatt
gtttttgcaattgcccaaaatggtttctttttagatacggaaagttctaagaaaatactt
gcgttagaagatgaacagcccattgtggacgccttcatgaaaactgtcgatactagtgat
ccattggcgcgcattcatgctttaaagagtgcgggtgactttgatattttcttccctgta
gttcatggtaacttaggagaagatggtacactgcaaggtttatttaaactattagataaa
ccatatgtgggggcaccgttacgtggccatgcggtaagctttgacaaagctttgactaaa
gaactattgacggtaaatggtattcgcaatactaaatacattgtggtggaccctgagtca
gcaaacaattggtcgtgggataagattgtggctgaattaggcaacattgtgtttgttaaa
gctgctaatcaaggatcttcagtgggaatttcacgtgtaaccaatgccgaagaatatact
gaagcattatcagattcattccaatatgattataaagttttgatagaagaagcagtcaat
ggtgcccgagagttggaagttggtgtgattggtaacgatcagccgcttgtctctgagatt
ggcgcacatacagtgccaaatcagggtagtggggacggttggtatgattataataataag
ttcgttgataattccgctgttcactttgaaattcctgctcagttatccccagaagtaaca
aaagaagttaaacaaatggctttagatgcttataaagtattgaatttacgtggcgaagcg
cgaatggattttttgttagatgaaaataatgttccctacttaggtgaaccaaacacgtta
ccagggttcacgaatatgtcgttatttaaacgtttgtgggattattctgatattaacaac
gccaagctagttgatatgttgattgactacgggtttgaagattttgcacaaaataaaaaa
ttgagttactcatttgtgtcacttggagaagaaaagatagggaagtttaactaa

DBGET integrated database retrieval system