KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_02525Help
Entry
MI1_02525         CDS       T01768                                 

Definition
(GenBank) amino acid ABC transporter ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
lmm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lmm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MI1_02525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmm02000]
    MI1_02525
Transporters [BR:lmm02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    MI1_02525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase ABC_membrane SMC_N AAA_5 AAA_29 YhhN RuvB_N MMR_HSR1 Claudin_3 Zeta_toxin AAA_28 AAA_16 AAA PduV-EutP NACHT AAA_18 Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: AET29965
LinkDB All DBs
Position
526441..528165
Genome map
AA seq 574 aa AA seqDB search
MKRLKKLLSQDRWILPSLRQQKSGLFWSIFLNFMITFAAGALMFVSGFLISRSAQHPSNI
LIIYVPIVLTRAFGIARPVFRYAQRLVSHNWVLRVVSKTRKRLYESAASTASSIRGQLQT
GEVLSLLADDLDRLQNLYLRTLFPLGSGMVLYLFLTIAIGTINWLFMLWWFVMLAVILVI
VPLLSLAVNYKGVQQQKKLQQSLYIDATDAILGLQDWVLSGRQEDLVQNQGETMSRLAHV
KNQSMKFGWWRDFVIQVLVLILTITTLMWATNQFSDSSSTVNYIAAFTLAIFPLIDSFIA
VNQGVSESSFYEDSIVRLNDLPEPTLLQETRHTTNSAVINFNQVTFKYGDKTIVDNLSFE
VQPKEKIALLGRSGAGKTTLLKLLAGDIQSSLGEVTIDETPVQNLQGSMSSLVAVLDQQA
YLFDTTIMNNVRMGNIHATDEQVQKAIKQAGLQPLINSLPNGYYTQMQEAGTRFSGGERQ
RFALARIMLQDAPIVVLDEPTVSLDPKTEYEVLSQIFSVLKDRTIIWVTHHLTGIENVDK
VYFLENGKFTLSGSPAELHQTSARFKQLLLMDQY
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattgaaaaaattattatcacaagatagatggattcttccgtccttacgtcaa
caaaaatctggccttttttggtcaatatttttgaattttatgattacttttgccgctggt
gcattaatgtttgtatccggatttctaatttctcgttctgcgcaacatccttctaatatt
ctcattatttacgttccaattgtgctgacacgtgcatttggcattgcgcgtccagttttt
cgttatgcacagcgtttggtgtcacacaattgggtattacgtgtcgtttcgaaaacacgt
aagcgtttatacgaaagtgcggccagcacggctagcagtattcgaggacaactgcaaaca
ggtgaagtacttagtttacttgctgacgatttagaccgtttacaaaatctctaccttaga
acgctttttccattaggttcaggtatggtattgtacctttttctcacaatagcaattggc
acaattaattggttattcatgttgtggtggtttgttatgttggctgttatcttggttatt
gtgccattattgagtttggcagtgaactataaaggtgtgcaacaacaaaagaaattacag
caaagtctttatatagatgcaaccgatgctattttaggtttgcaagattgggtgctatca
ggacgacaagaagatttagtacaaaatcaaggcgaaacaatgtcaagattagctcatgtt
aagaaccaaagtatgaaatttggctggtggcgtgattttgtcattcaagttttagtattg
atattgactataacaaccttaatgtgggcaaccaatcagttttctgatagttcaagtaca
gttaattatattgcggctttcacacttgcaatatttcctctaattgatagctttattgct
gtgaatcaaggtgtaagtgaatcctcattctacgaagatagcattgtgcggttaaatgat
ttaccagaaccaaccttgctacaggagactagacacacaactaactcagcagtaattaat
tttaatcaagtcacatttaagtatggggacaaaacaattgttgataatttgtcatttgaa
gttcagcctaaagaaaaaattgcgttacttggtcgttcaggcgcaggaaaaacaacttta
ttaaagcttttggcaggtgatatccaatcatctttgggtgaagtaacaatcgatgaaacg
ccagtccagaacttacaagggagtatgtctagtttggtggctgtgttggatcaacaggcg
tatttatttgatacaacgattatgaacaacgtgcgtatgggaaatattcatgccactgat
gagcaagttcaaaaagcaattaagcaagctgggttacagccattaatcaattccttaccc
aacggatactatacacaaatgcaggaagcaggaacacgcttttctggtggagaacggcaa
agatttgccttagcacgaatcatgctgcaagatgcgccaattgtggtgctagatgaacca
acagtatcactagatcccaaaacagagtacgaggttttatcccaaatattttcagttctc
aaagatcgaacgattatttgggtcacacatcatttgacaggaatcgaaaatgttgataaa
gtttactttttagagaatggaaaattcacgttgagcggttcaccggctgaattgcatcaa
acttcagcaagatttaaacaattattactcatggatcaatattaa

DBGET integrated database retrieval system