KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_07315Help
Entry
MI1_07315         CDS       T01768                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
lmm00620  Pyruvate metabolism
lmm00680  Methane metabolism
lmm01100  Metabolic pathways
lmm01120  Microbial metabolism in diverse environments
lmm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MI1_07315
  09102 Energy metabolism
   00680 Methane metabolism
    MI1_07315
Enzymes [BR:lmm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MI1_07315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: AET30905
LinkDB All DBs
Position
1525114..1526628
Genome map
AA seq 504 aa AA seqDB search
MTSRKIPSIMGTQHPDNANAPFWESSQQPFISAYRETGEAFENFNELNVDEYMWDWEGKH
ADAAVIDRLFSTEYDYFKDHQIGRDKFLTFRFPNIWEEKGYNLMQAMTAFLSSEDFAHDL
GFSRPLFEAILPMAQRADQILKMQVLFEKLANFKSAEFTRSDKNTPYIEMIPLFEDFETQ
LHAPEILKEYLNLHEEHFGFRPKYMRVFLAGSDSALTAGFMSSITGNKLAIARLHEFAEE
ENIEIFPISGTGSAIFRGGLSPHRIDRYVTEFPGVRTATVQSAFRYDFPIEEVQKGIAEL
KEKLPVAEPLKISLDDQKILTEIAEESAKFYSNTLDNLVPSMQAIFKAFPKRRDRRQHVG
VLGYSRSVDGIELPRAINFTGSFYSVGVPPEFIGFGRALKHLDADHLSVFVRSYPSMSKD
FNELARFVNMDALQILKTQNAAWAEVEEDILIMQRIFKFEIGPQTREEQQHAEIALQVVQ
FKDGAPVAITALINRMAQLRHFLG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacgtaaaatcccttcaatcatgggaacgcaacatccagataatgctaatgcg
ccattctgggaaagttctcagcaaccatttatcagtgcctatcgagaaaccggtgaagca
tttgaaaactttaatgaattaaatgtcgatgagtatatgtgggattgggaaggtaaacat
gctgatgcagctgtcattgatcgcttgtttagcacagagtatgattatttcaaagatcat
caaatcggtcgtgacaagtttttaactttccgtttccctaatatttgggaagaaaaaggc
tacaacttaatgcaagcgatgactgccttcttaagttctgaagacttcgcccatgatctt
ggattctctcgaccattatttgaagctattctgccaatggcacagcgtgcagaccaaatt
ttgaaaatgcaagttttgtttgaaaaattagcaaacttcaaatcagcagaatttactcgc
tctgataaaaacacaccctatattgaaatgatccctctttttgaggattttgaaacgcaa
ttacatgcacctgaaattttaaaggagtatttaaacctccacgaagaacattttggcttc
cgaccaaaatatatgcgtgtattcttagccggatctgattctgctttaacagctggattt
atgagttcaattaccggtaacaaactagcaattgcgcgacttcatgagtttgctgaagaa
gaaaacattgaaattttcccaatttcaggaaccggatcagcaattttccgtggtggttta
tctccacaccgcatcgatcgctacgtaacagaatttccaggggtacgcacagcaactgtt
caatcagcattccgttacgactttcctattgaagaagtgcaaaaaggcatcgctgaatta
aaagaaaaattgccggttgcagaaccattaaaaatttctcttgatgatcaaaagatttta
actgagatagctgaagagtccgctaagttttattctaatacgctagacaatttggttcct
agcatgcaagcgattttcaaggcgttcccaaagcgtcgtgatcgccgtcaacacgttggt
gttcttggatattcacgttcagttgatggcatcgaattaccaagggccattaacttcact
ggctcattctactcagtcggtgtcccaccagaatttattggttttgggcgcgcattgaag
catttagatgctgatcatttgagcgtatttgttcgctcatatcctagcatgagcaaagac
tttaatgaattagcacgcttcgttaatatggatgctttgcaaattctaaaaactcaaaat
gctgcttgggccgaagttgaagaagatattctcatcatgcaacgtattttcaagtttgaa
attggtcctcaaacgcgcgaagaacaacaacatgctgaaatagcacttcaagtagtgcaa
tttaaagatggtgctccagttgccattacagcccttattaaccgcatggcacaattacga
cacttcctcggataa

DBGET integrated database retrieval system